SecReT6
Protein ID: 448242786
SecReT6 ID730
T6SS typei3
Gene symbolimpF
Locus tagSMWW4_v1c30260
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3263552..3264127 [+]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDL7ZME5
KEGG IDsmw:SMWW4_v1c30260
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-18, Aligned region: 59..170
Protein Sequence: 191 a.a.     [Download]
>gi|448242786|ref|YP_007406839.1| type VI secretion system protein ImpF [Serratia marcescens WW4]
MNDKRPPHYDGGDLRHQGYRYRQDSERLTSRDKMQPVLLDMLTDDEPQKKQEAQVRNLVSHSELRRRVLR
DLQWLFNCVNSESNLDLGDFPQVRRSTLNYGIASLAGKRMSDIEWLDIQRALTESILHFEPRILPEGLQV
RCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFDLKDIG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3263552-3264127 Serratia marcescens WW4, complete genome
ATGAACGATAAGCGCCCACCCCACTACGACGGCGGCGATCTGCGCCACCAGGGCTATCGCTATCGTCAGG
ACAGCGAACGCCTGACCTCGCGCGACAAAATGCAGCCGGTGCTGCTCGATATGCTGACCGACGACGAACC
GCAGAAAAAGCAGGAGGCGCAGGTGCGCAACCTGGTGTCGCACAGCGAGCTGCGCCGCCGGGTATTGCGC
GATCTGCAGTGGCTGTTCAACTGCGTCAACAGCGAATCCAATCTGGATCTCGGCGATTTTCCGCAGGTGC
GGCGCTCCACCCTGAATTACGGCATCGCCTCGCTGGCGGGCAAGCGCATGTCGGACATCGAATGGCTCGA
CATTCAGCGCGCGCTGACCGAATCCATTCTCCATTTCGAGCCGCGCATTTTGCCCGAGGGGCTGCAGGTG
CGCTGCATCTCGGATACCGGCTCGCTGGAGCTGCACAACGTGCTGTCGATCGAAATCAAGGGCCGCCTGT
GGTGCGTGCCCTATCCGCTGGAGTTTCTGTTCCGTACCGACGTGGATCTGGAAAACGGCCACTTCGATCT
GAAAGACATAGGGTAA