SecReT6
Protein ID: 448242788
SecReT6 ID730
T6SS typei3
Gene symbolimpH
Locus tagSMWW4_v1c30280
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3266015..3267085 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDL7ZNX4
KEGG IDsmw:SMWW4_v1c30280
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.00E-108, Aligned region: 31..334
Protein Sequence: 356 a.a.     [Download]
>gi|448242788|ref|YP_007406841.1| type VI secretion system protein ImpH [Serratia marcescens WW4]
MSAEMIATELAPPQINALYRLPDDFWPRLRSAPYKHDLFQLLRRIDAQGGQPYLLGRAPLPRHEMLRLGQ
EPSLSFAPSTLAQVAPRANSPLHDVSIFSFGLFGPNGPLPLHLTEYVRERVYHHQDTTLLAFTNLFHHRL
TLLFYRAWADAQPTVSLDRPDNRRFDEYLSSLIGIGQPAQQERDSINAHAKHFMAGHLIRHSRDPEGLSK
ILQQYFKVPVRIVENVPHWLRVEPREQARLKAGRGAPRLGESAFLGIAVRDIQHKFRIELGPMPQQDYDR
FLPGAELCRQLRDWVRQYLGIEFVWEVRLILAKEQAHGIQLGGAQRLGLSSWLADHRRQRDLDDLIFSPE
PLENPF
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3266015-3267085 Serratia marcescens WW4, complete genome
ATGAGCGCGGAGATGATCGCCACCGAACTGGCGCCGCCGCAGATCAATGCGCTGTATCGGCTGCCGGACG
ACTTCTGGCCGCGGCTGCGCAGTGCGCCTTACAAGCACGATCTGTTTCAACTGCTGCGACGCATCGACGC
CCAGGGCGGCCAGCCCTATCTGCTGGGGCGCGCGCCGCTGCCGCGCCACGAGATGCTGCGCCTGGGCCAG
GAGCCGTCGCTGTCGTTCGCGCCCTCCACGCTGGCGCAGGTGGCGCCACGCGCCAACAGCCCGCTGCACG
ACGTTTCGATCTTCAGCTTCGGCCTGTTCGGCCCCAACGGGCCGCTGCCGCTGCACCTGACCGAATACGT
ACGCGAACGGGTGTACCACCATCAGGACACCACCCTGCTGGCGTTCACCAACCTGTTCCATCACCGGCTG
ACGCTGCTGTTTTACCGCGCCTGGGCCGACGCGCAGCCGACGGTATCGCTGGATCGCCCGGACAACCGGC
GCTTCGACGAGTATCTGTCGAGCCTGATCGGCATCGGCCAGCCGGCGCAACAGGAGCGCGACAGCATCAA
CGCCCACGCCAAGCATTTTATGGCCGGTCATCTGATTCGCCACAGCCGCGATCCGGAAGGCCTGAGCAAG
ATTTTGCAGCAGTATTTCAAGGTGCCGGTGCGCATCGTCGAAAACGTGCCGCACTGGCTGCGGGTGGAAC
CGCGCGAACAGGCGCGGCTCAAGGCCGGGCGCGGTGCGCCGCGGCTCGGCGAGTCGGCCTTTCTCGGCAT
CGCGGTGCGCGATATCCAGCACAAGTTCCGCATCGAGCTGGGGCCGATGCCGCAGCAGGACTATGACCGC
TTCCTGCCGGGCGCCGAGCTGTGCCGGCAACTGCGCGACTGGGTGCGCCAATACCTGGGCATCGAGTTCG
TCTGGGAAGTGCGCCTGATCCTGGCGAAGGAACAGGCGCACGGCATCCAGCTCGGCGGCGCGCAGCGATT
GGGCCTGAGCAGTTGGCTGGCCGACCATCGGCGACAGCGCGATCTCGACGATCTGATCTTCAGCCCTGAA
CCGCTGGAAAACCCGTTCTGA