SecReT6
Protein ID: 448242789
SecReT6 ID730
T6SS typei3
Gene symbolvasG
Locus tagSMWW4_v1c30290
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3267142..3269799 [+]
Producttype VI secretion system protein VasG
NoteTssH
UniProt IDL7ZH19
KEGG IDsmw:SMWW4_v1c30290
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-39, Aligned region: 225..303
AAA_2 [PF07724], Evalue: 2.80E-39, Aligned region: 616..781
AAA [PF00004], Evalue: 2.90E-21, Aligned region: 123..156
AAA [PF00004], Evalue: 2.90E-21, Aligned region: 226..359
AAA [PF00004], Evalue: 2.90E-21, Aligned region: 622..706
ClpB_D2-small [PF10431], Evalue: 6.40E-16, Aligned region: 207..220
ClpB_D2-small [PF10431], Evalue: 6.40E-16, Aligned region: 789..864
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 226..246
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 352..375
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 621..739
AAA_16 [PF13191], Evalue: 7.80E-10, Aligned region: 33..80
AAA_16 [PF13191], Evalue: 7.80E-10, Aligned region: 203..243
AAA_16 [PF13191], Evalue: 7.80E-10, Aligned region: 271..304
AAA_16 [PF13191], Evalue: 7.80E-10, Aligned region: 486..558
AAA_16 [PF13191], Evalue: 7.80E-10, Aligned region: 617..821
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 58..77
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 226..311
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 373..392
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 620..656
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 212..240
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 297..306
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 621..735
AAA_14 [PF13173], Evalue: 6.90E-07, Aligned region: 59..78
AAA_14 [PF13173], Evalue: 6.90E-07, Aligned region: 227..306
AAA_14 [PF13173], Evalue: 6.90E-07, Aligned region: 620..731
AAA_19 [PF13245], Evalue: 1.70E-06, Aligned region: 224..248
AAA_19 [PF13245], Evalue: 1.70E-06, Aligned region: 619..643
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 123..163
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 225..242
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 615..671
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 220..250
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 282..322
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 611..643
AAA_17 [PF13207], Evalue: 1.60E-05, Aligned region: 226..281
AAA_17 [PF13207], Evalue: 1.60E-05, Aligned region: 453..488
AAA_17 [PF13207], Evalue: 1.60E-05, Aligned region: 621..657
IstB_IS21 [PF01695], Evalue: 4.90E-05, Aligned region: 209..247
IstB_IS21 [PF01695], Evalue: 4.90E-05, Aligned region: 621..647
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 218..243
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 619..646
NACHT [PF05729], Evalue: 0.00011, Aligned region: 226..254
NACHT [PF05729], Evalue: 0.00011, Aligned region: 280..328
NACHT [PF05729], Evalue: 0.00011, Aligned region: 621..660
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 205..239
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 278..310
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 620..663
AAA_18 [PF13238], Evalue: 0.00035, Aligned region: 226..246
AAA_18 [PF13238], Evalue: 0.00035, Aligned region: 622..650
Clp_N [PF02861], Evalue: 0.0006, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.0006, Aligned region: 116..133
Clp_N [PF02861], Evalue: 0.0006, Aligned region: 518..530
T2SE [PF00437], Evalue: 0.0033, Aligned region: 208..242
T2SE [PF00437], Evalue: 0.0033, Aligned region: 618..698
TSKS [PF15358], Evalue: 0.0074, Aligned region: 427..505
Hpr_kinase_C [PF07475], Evalue: 0.0082, Aligned region: 226..238
Hpr_kinase_C [PF07475], Evalue: 0.0082, Aligned region: 618..639
TIP49 [PF06068], Evalue: 0.0096, Aligned region: 226..245
TIP49 [PF06068], Evalue: 0.0096, Aligned region: 275..306
TIP49 [PF06068], Evalue: 0.0096, Aligned region: 620..657
Protein Sequence: 885 a.a.     [Download]
>gi|448242789|ref|YP_007406842.1| type VI secretion system protein VasG [Serratia marcescens WW4]
MSEISRSVLFGKLDSLLFTSLESATAFCKLRGNPYVELAHWLHQLMQSPDGDLQQIVRHFALDEAQLARD
IVEALDRLPRGASAISDLSEHIDSAVERAWVYGSLKFGAARIRGGHLLLGILKTYSLRHLLKAISPQFER
INADLLMEQFAVITAHSAENAQDAPAESRAENASGAARSGESVLAQYAQDLTARARDGEIDPVAGRDEEI
RQIIDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIVAGDVPPQLRDVKLCLLDIGMLQAGAGVKGEFEK
RLQAVIDEVQSSPTPIILFIDEIHTLIGAGGAQGTGDAANLLKPALARGQLRTIGATTWSEYKKYIEKDP
ALTRRFQVVQVHEPSEDKALLMLRSTVSPLEQHHRVLLLDEAVDAAVRLSHRYIPARQLPDKAVALLDTA
CARVAVSQHAEPAQVEDCRHRIDALQIELDIARREAKVGIGDPLRPQEIEAQLTALRLELKQLTERWQQE
LTLIQEIITLRAQLHRQEAEEPAGEETEAGPDADALRAQLGELQQQLSALQGEAPLIFAAVDANIVAAVV
ADWTGIPLGRMVKNEIEAVLQLSATLNQRVIGQRHALDLIARRVRTSRARLDDPNKPVGVFLLAGPSGVG
KTETALALAETLYGGEQNVITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIE
KAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLIAGLCSDPELLPEPEALSGALRQPLL
SVFPAALLGRLLVVPYYPLTDATLGNIVRLQLGRIQRRLAENHDIVCTFDDAVIEQIVSRCTEVESGGRM
VDAILTNTLLPQISHTLLTGSANDQRYRQLHIALQNHEFICQFQA
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3267142-3269799 Serratia marcescens WW4, complete genome
ATGTCTGAAATCAGCCGCTCGGTATTATTTGGCAAACTGGATAGCCTGTTATTCACCTCTCTGGAAAGTG
CGACGGCGTTTTGCAAGCTGCGCGGTAACCCCTACGTCGAATTGGCGCACTGGCTGCATCAGCTGATGCA
ATCGCCGGACGGCGATCTGCAGCAGATCGTCCGCCACTTCGCGTTGGACGAGGCGCAGCTGGCGCGCGAC
ATCGTCGAGGCGCTCGATCGCCTGCCGCGCGGCGCCAGCGCCATCTCCGATCTGTCCGAGCACATCGACA
GCGCGGTAGAACGCGCCTGGGTCTATGGCTCATTGAAATTCGGCGCGGCGCGCATCCGCGGCGGCCACCT
GCTGCTCGGCATTCTGAAAACCTACAGCCTGCGCCATCTGCTGAAGGCCATTTCCCCGCAGTTCGAGCGC
ATCAACGCCGATCTGTTGATGGAGCAGTTCGCCGTCATTACCGCTCACTCGGCGGAAAACGCCCAGGATG
CGCCGGCGGAAAGCCGCGCCGAGAACGCATCCGGCGCGGCGCGCAGCGGTGAAAGCGTGCTGGCGCAGTA
TGCCCAGGATCTGACCGCCAGAGCGCGCGACGGCGAGATCGACCCGGTGGCCGGCCGCGATGAAGAGATC
CGGCAAATCATCGATATCCTGATGCGCCGCCGCCAGAACAACCCGCTGCTGACCGGTGAGGCCGGCGTCG
GGAAAACCGCGGTGGTGGAAGGCCTGGCGCTGCGCATCGTGGCCGGCGATGTGCCACCACAGCTGCGCGA
CGTGAAACTGTGCCTGCTGGACATCGGCATGCTGCAGGCCGGCGCCGGCGTTAAGGGCGAGTTTGAAAAA
CGGCTGCAGGCGGTGATCGACGAAGTGCAGTCCAGCCCGACGCCAATCATCCTGTTTATCGACGAAATTC
ACACCCTGATCGGCGCCGGCGGCGCCCAGGGCACCGGCGACGCCGCCAACCTGCTGAAGCCGGCGCTGGC
GCGCGGCCAACTGCGCACCATTGGCGCCACCACCTGGTCGGAATACAAGAAATACATCGAGAAAGACCCG
GCGCTCACCCGCCGTTTCCAGGTGGTGCAGGTGCACGAACCGAGCGAAGACAAAGCGCTGCTGATGCTGC
GCAGCACCGTCAGCCCGCTGGAGCAACACCACCGCGTGCTGCTGCTGGATGAAGCGGTGGACGCCGCGGT
GCGGCTGTCCCATCGCTATATTCCGGCCCGCCAGTTGCCGGACAAGGCGGTGGCGCTGCTGGATACCGCC
TGCGCGCGCGTGGCGGTCAGCCAACACGCCGAACCCGCCCAGGTTGAAGACTGCCGCCATCGCATCGATG
CGCTGCAGATCGAATTGGATATCGCCCGCCGCGAGGCCAAGGTCGGCATCGGCGATCCCCTGCGCCCGCA
GGAGATTGAAGCTCAGCTGACCGCGCTGCGCCTGGAGCTCAAACAGCTGACCGAGCGCTGGCAGCAAGAG
CTGACGCTGATCCAAGAGATCATCACACTGCGCGCCCAGCTGCACCGGCAGGAAGCGGAGGAGCCTGCCG
GCGAAGAAACGGAGGCGGGCCCTGACGCCGACGCGCTGCGCGCCCAACTGGGCGAGCTGCAGCAGCAACT
GAGCGCGCTGCAGGGCGAAGCGCCGCTGATCTTCGCCGCCGTCGACGCCAACATCGTGGCGGCGGTGGTG
GCCGACTGGACCGGCATCCCGCTGGGCCGCATGGTGAAAAACGAGATTGAAGCGGTGCTGCAACTCTCCG
CCACCCTGAACCAGCGCGTCATCGGCCAACGCCATGCGCTGGATCTGATCGCCCGCCGGGTGCGCACCTC
ACGGGCGCGGCTGGACGATCCGAACAAGCCGGTCGGGGTGTTCCTGCTGGCCGGGCCCTCCGGCGTCGGC
AAAACCGAAACCGCGCTGGCGCTGGCGGAAACCCTGTATGGCGGCGAGCAGAACGTCATCACCATCAACA
TGAGCGAATTCCAGGAGTCGCACACCGTTTCGACGCTGAAAGGCGCGCCGCCCGGCTATGTCGGCTACGG
CGAAGGCGGCGTGCTGACCGAGGCGGTGCGCCGCCGTCCTTACAGCGTGGTGCTGTTGGACGAGATCGAG
AAAGCGCACCCGGACGTCCATGAAATCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAGGACGGCGAAG
GCCGCCATATCGATTTCCGCAACACCATCATCATCCTGACCTCCAACGTCGGCACCGATCTGATCGCCGG
GCTGTGCAGCGATCCGGAGCTGCTGCCGGAGCCGGAGGCGCTGAGCGGCGCGCTGCGCCAACCGCTGCTG
TCGGTGTTCCCGGCCGCCTTGCTCGGCCGCCTGCTGGTGGTGCCGTATTACCCGCTGACCGACGCCACGC
TGGGCAACATCGTGCGCCTGCAGTTGGGCCGCATTCAGCGCCGTCTGGCGGAGAATCACGACATCGTCTG
CACCTTCGACGACGCGGTTATCGAGCAGATCGTCAGCCGCTGCACCGAGGTGGAGTCCGGCGGCCGCATG
GTCGACGCCATCCTGACCAACACCCTGCTGCCGCAGATCAGCCACACCCTGCTGACCGGCAGCGCCAACG
ACCAGCGCTATCGCCAGCTGCATATCGCGCTGCAGAACCACGAATTCATTTGTCAATTTCAGGCATAA