SecReT6
Protein ID: 448242791
SecReT6 ID730
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c30310
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3271436..3273364 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL7ZME8, L7ZME8
KEGG IDsmw:SMWW4_v1c30310
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-78, Aligned region: 25..330
Phage_base_V [PF04717], Evalue: 8.00E-25, Aligned region: 368..461
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 504..526
Protein Sequence: 642 a.a.     [Download]
>gi|448242791|ref|YP_007406844.1| Rhs element Vgr protein [Serratia marcescens WW4]
MLDRIIAHTPLGQEQLLFRSLDGIEALSTPFDFSIELLSTDARLDRKALLGQPLTLEIPTQGFLSAPRYL
NGKITAIAVSSEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQIVKTLLAEHNVQLEDQLTGDY
RLWGYCVQYNESSFNFISRLMELEGIYYYFKHEMGKHTLVLGDAPHHHQPYPGYEMIPYHLTPSGGSTSE
EGISQWTLSDRVTPGIYSLDDYDFRKPNAWLFQARQNPVSPTPGQIDVYDWPGRYTEHQQGEFYARVRQE
AWQAEHQQIRGTATAMGIAPGSTFTLYNAPHADDNREYLTLQANYHLKENRYASGDDQSSEHRIDFTVLP
ADVPWHPPQQASWPKTHGPQTARVVGPAGESIWTDKYGRIKVKFHWDRFGPKDDGSSCWVRVSSAWAGQG
YGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRTKDGTADNANALRFED
KAGAEQVWIQAERNMDTQVKNDESHTIANDHTHLVGGNQIKRVVLNQATGVKGESSALTGKTRSDAVVNA
FTLGSGESLRLECGESVIELLADGQINITGTSFNITVKEDGAINTGGQLDLNQPGGAARTAAPGGGHQAA
IQSAVDQLFPKE
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3271436-3273364 Serratia marcescens WW4, complete genome
ATGTTGGATCGCATTATTGCGCACACGCCGCTGGGCCAGGAGCAACTGCTGTTCCGCTCGCTGGACGGCA
TCGAAGCGCTTTCCACTCCTTTCGACTTCTCTATTGAATTGCTGAGCACCGACGCGCGGCTCGATCGCAA
AGCGCTGCTCGGCCAACCGCTGACGCTGGAGATCCCTACCCAGGGCTTTCTCAGCGCCCCGCGCTACCTG
AACGGCAAGATCACCGCCATCGCCGTCAGCAGCGAAGAGATCGGCGGCACGCGCTACGCGGTGTATAACC
TGCACGTGCAGCCGGATCTGTGGCCGATGACCAAAGACCGCAACTTCCGCATCTTCCAGGAACAGACGGT
GCCGCAGATCGTCAAGACCCTGCTGGCGGAGCACAACGTGCAGCTGGAAGATCAGCTGACCGGCGACTAT
CGCCTGTGGGGCTACTGCGTGCAGTACAACGAAAGCAGCTTCAACTTCATCAGCCGCCTGATGGAGCTGG
AGGGCATCTATTACTATTTCAAACACGAGATGGGCAAGCACACGCTGGTGCTCGGGGATGCGCCCCACCA
CCACCAGCCTTATCCCGGCTACGAGATGATCCCCTACCATCTGACGCCGTCCGGCGGCAGCACCAGCGAG
GAAGGCATCAGCCAGTGGACATTGTCCGATCGCGTCACGCCGGGCATCTACAGCCTGGACGACTATGATT
TTCGCAAACCTAACGCCTGGCTGTTCCAGGCGCGGCAAAACCCGGTCTCCCCCACGCCGGGGCAGATCGA
CGTTTACGACTGGCCAGGCCGCTATACCGAGCATCAGCAAGGGGAGTTCTACGCCCGCGTGCGCCAGGAA
GCCTGGCAGGCCGAGCATCAGCAGATCCGAGGCACCGCCACCGCCATGGGCATCGCCCCCGGCAGCACCT
TTACGTTGTATAACGCCCCGCACGCCGACGACAACCGCGAGTACCTGACGCTGCAGGCCAACTATCACCT
GAAAGAGAACCGCTACGCCAGCGGCGACGATCAGAGTAGCGAACACCGTATCGACTTCACCGTGCTGCCG
GCGGACGTGCCCTGGCACCCGCCGCAGCAGGCCAGCTGGCCGAAAACCCACGGGCCGCAGACCGCCCGGG
TGGTCGGCCCGGCCGGCGAATCGATCTGGACCGATAAATACGGCCGCATCAAGGTGAAATTCCACTGGGA
TCGCTTCGGGCCGAAAGACGACGGCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCCAGGGC
TACGGCGGTGTGCAGATCCCGCGCGTCAACGACGAAGTGGTGGTGGACTTTATCAACGGCGATCCGGATC
GGCCGATCGTCACCGGGCGCGTCTATAACGAAGCCAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCCAC
CCAGATGGGCTTTATGAGCCGCACCAAGGACGGCACCGCCGACAACGCCAACGCCCTGCGTTTCGAAGAC
AAGGCCGGCGCCGAGCAGGTGTGGATCCAGGCGGAGCGCAACATGGACACCCAGGTGAAAAACGATGAGA
GCCACACCATCGCTAACGACCACACCCACCTGGTGGGCGGCAACCAGATCAAGCGGGTGGTGCTCAATCA
GGCCACCGGCGTCAAAGGCGAATCCTCCGCGCTGACCGGCAAAACGCGCAGCGACGCCGTGGTCAATGCC
TTTACCCTCGGCTCCGGCGAATCGCTGCGGCTCGAGTGCGGCGAAAGCGTGATCGAACTGCTGGCGGACG
GCCAAATCAACATCACCGGCACCAGTTTCAATATCACGGTGAAAGAGGATGGCGCGATCAACACCGGCGG
CCAGCTGGATCTCAACCAGCCTGGCGGCGCCGCACGCACCGCCGCACCGGGTGGCGGCCATCAGGCGGCA
ATCCAGAGCGCCGTCGATCAGTTGTTCCCTAAAGAGTAG