SecReT6
Protein ID: 448242906
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31460
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3390536..3392047 [-]
Producthypothetical protein
NoteTssL
UniProt IDL7ZMR8
KEGG IDsmw:SMWW4_v1c31460
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-40, Aligned region: 112..306
DUF2077 [PF09850], Evalue: 2.30E-40, Aligned region: 432..472
OmpA [PF00691], Evalue: 3.00E-13, Aligned region: 368..470
Protein Sequence: 503 a.a.     [Download]
>gi|448242906|ref|YP_007406959.1| hypothetical protein SMWW4_v1c31460 [Serratia marcescens WW4]
MNEFERKIREAMAVTRNNATPRLPASGSVGKTTAEIAALSFGARALAAKLRPGSAGVATPPEPKPYEAES
VAPESSEPAPGERPAEAAPTSSGLFGRAALSKPGVMMGHWDNPLIAAAIPVLLQVERVRDQKQLNPGAVR
AQIVREIQQFQQTLLADHIAPSDVDKLAYLLCSYVDECCMSTLESGELNLSLLVEFYRDAWGGEKCFEHL
QAYLAASPRNKEILAFYDLILSLGFEGQYHVMERGAVLLADVRNRLDGYLYSQNPTQTLADAEPSKVVRK
ATRITPLKLLCYGLAIALLAYASAAWYLHDQSRALRNAILAWTPPQPRKINIMETLPQPLPQILSEGWLE
VRADPRGWLLIFTSDGAFATGQSKLSEEFKKKRNIERLGEALAPWPGDLEVIGHTDNKPYRNTSNNSNLK
LSEARAQTVADKLRESLANSKYNRTVTSVGKGDQEPLDDNATEEGRRRNRRVDILWKIGEREMASPSATL
NQAGVAAEVPEDN
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3392047-3390536 Serratia marcescens WW4, complete genome
ATGAACGAATTCGAGAGAAAAATACGCGAGGCGATGGCGGTAACGCGCAACAACGCGACGCCGCGCCTTC
CCGCGTCCGGCTCGGTGGGCAAAACGACGGCGGAGATCGCCGCGCTGTCCTTCGGCGCGCGGGCGCTGGC
CGCCAAGCTGCGGCCGGGAAGCGCCGGGGTGGCGACGCCCCCCGAACCCAAGCCTTATGAAGCGGAAAGC
GTTGCGCCGGAAAGCAGCGAGCCCGCGCCGGGCGAGCGCCCGGCCGAGGCGGCGCCGACCTCGAGCGGGC
TGTTCGGCCGCGCCGCGCTGAGCAAGCCCGGTGTGATGATGGGCCATTGGGACAACCCGTTGATCGCCGC
CGCCATCCCGGTTCTGCTGCAGGTGGAGCGGGTGCGCGATCAGAAACAGCTGAATCCGGGCGCGGTGCGC
GCGCAGATCGTGCGTGAGATCCAACAATTTCAGCAGACGCTACTGGCGGATCACATCGCGCCGAGCGATG
TGGACAAGCTGGCCTATCTGCTGTGCTCCTACGTGGATGAGTGCTGCATGAGCACGCTCGAATCCGGCGA
ACTGAATCTCAGCCTGCTGGTGGAGTTTTATCGCGACGCCTGGGGCGGGGAAAAGTGCTTCGAGCACCTG
CAGGCCTATCTGGCCGCCTCGCCGCGCAACAAGGAGATCCTGGCGTTTTACGATCTGATCCTGTCGCTGG
GCTTCGAAGGGCAATACCACGTGATGGAACGCGGCGCTGTGCTGTTGGCCGATGTGCGCAACCGTCTTGA
CGGCTATCTGTACAGCCAGAACCCGACGCAGACGCTGGCCGATGCCGAGCCGAGCAAAGTGGTGCGCAAG
GCGACCCGCATCACGCCGCTGAAGCTGCTGTGCTACGGCCTGGCCATCGCGCTGCTGGCGTATGCCTCGG
CCGCCTGGTATCTGCACGATCAGTCCCGCGCGCTGCGCAACGCCATTTTGGCCTGGACACCGCCGCAGCC
GCGCAAAATCAACATCATGGAGACGCTGCCGCAGCCGCTGCCGCAAATCCTCAGCGAAGGGTGGCTGGAG
GTGCGCGCCGATCCGCGCGGCTGGCTGTTGATCTTCACCTCTGACGGTGCATTCGCCACCGGGCAGTCGA
AGCTGTCGGAAGAGTTTAAAAAGAAACGCAACATCGAGCGTTTGGGGGAGGCGCTGGCGCCGTGGCCGGG
CGATCTGGAGGTCATCGGGCATACCGACAACAAACCGTATCGCAACACCTCCAACAACTCCAACCTGAAA
CTGTCCGAGGCGCGCGCGCAGACGGTGGCCGACAAGCTGCGCGAATCCTTGGCCAACAGTAAATACAACC
GCACCGTGACCTCGGTCGGCAAGGGCGATCAGGAGCCGCTGGACGACAACGCGACGGAAGAAGGGCGCCG
CCGCAACCGCCGCGTGGACATCCTTTGGAAAATCGGCGAGAGGGAGATGGCTTCACCGTCTGCAACGTTA
AATCAGGCAGGGGTAGCCGCCGAGGTCCCCGAGGATAACTAA