SecReT6
Protein ID: 448242907
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31470
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3392044..3393402 [-]
Producthypothetical protein
NoteTssK
UniProt IDL7ZQL4
KEGG IDsmw:SMWW4_v1c31470
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-113, Aligned region: 19..447
Protein Sequence: 452 a.a.     [Download]
>gi|448242907|ref|YP_007406960.1| hypothetical protein SMWW4_v1c31470 [Serratia marcescens WW4]
MLPKQRVAWVEGMLMEPQHFQQQERFFEHLIEARLRSVETFTWGFLTLEIDNGLLEQGKFALKKAKGVFP
DGTAFSMPEDIPLPPPLVLGEGCQGKVVCLSVLMDIAGNAQIDLIQDARKSSRFRTMDAEVPDRNHGVSL
EGTPRVCTMQLGSLVTRLSLEDAVSSAESVLPVGFVRELTSDRRVLLDERALPPMLDFRAIGWLPAFTTE
LLGLISQRLESVFRPDVHMTIGGLSELLELLLLQTLSEFNLRISQLLASPQVHPETLFDTLLSLLGRLSI
IPGGERLWDRADLVYLHDEPHNCYFQLFASIRRALSLVIEAPAVALPFVDRGDSIYLCPNDSQLRLEKLV
FAVSCGLSIEHLRSYFPAQVKLGPVEKIIQLIDLQLPGARLLPMASPPRHIPYYPNSIYFEVDHADPIYK
EMMAGSAMALSIVGDFPDLRFDVWGLRQGRVG
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3393402-3392044 Serratia marcescens WW4, complete genome
ATGTTACCTAAACAACGCGTCGCCTGGGTAGAAGGCATGTTGATGGAACCGCAGCATTTCCAGCAGCAGG
AACGTTTTTTCGAGCACTTGATTGAAGCGCGCTTGCGCAGCGTCGAAACCTTCACCTGGGGGTTCCTGAC
GCTGGAGATCGACAACGGGCTATTGGAACAGGGCAAGTTTGCGCTGAAGAAAGCCAAGGGCGTTTTCCCC
GACGGCACGGCGTTCAGCATGCCTGAGGATATACCGCTGCCGCCGCCGCTGGTGCTGGGAGAAGGCTGCC
AGGGGAAAGTGGTGTGCCTGTCCGTGCTGATGGACATCGCCGGCAACGCCCAGATCGATCTTATCCAGGA
TGCGCGAAAAAGCAGCCGTTTTCGCACCATGGACGCCGAGGTGCCGGATCGCAACCACGGCGTCAGCCTG
GAAGGGACCCCGCGCGTGTGCACGATGCAACTGGGCAGCCTGGTGACGCGGCTAAGCCTGGAGGACGCGG
TCAGCAGCGCGGAAAGCGTGCTGCCGGTCGGTTTCGTGCGCGAGCTGACCAGCGATCGTCGGGTGCTGCT
GGATGAGCGCGCCTTGCCGCCGATGCTGGATTTCCGCGCCATCGGCTGGCTGCCCGCTTTCACCACCGAA
TTGCTTGGGCTGATCAGCCAGCGTCTGGAGTCGGTTTTCCGCCCGGACGTGCATATGACGATCGGCGGGC
TTTCCGAGCTGCTGGAGTTGCTGTTGCTGCAAACCTTGAGCGAGTTCAATTTGCGCATCAGCCAACTGCT
GGCCAGCCCGCAGGTGCATCCTGAAACCCTGTTCGACACGTTGCTGAGCCTGCTGGGGCGGCTCAGCATC
ATTCCCGGCGGCGAACGCCTCTGGGATCGGGCCGATTTGGTGTATCTGCACGATGAGCCGCACAACTGCT
ACTTCCAGCTCTTCGCCTCGATTCGCCGCGCGCTGTCGCTGGTGATCGAAGCGCCGGCGGTGGCGTTGCC
GTTTGTCGATCGCGGCGACAGCATTTATCTGTGCCCGAACGACTCGCAGCTGCGCCTGGAAAAACTGGTG
TTCGCCGTCAGCTGCGGTTTGTCCATCGAGCATCTGCGCTCGTATTTCCCCGCGCAGGTCAAACTGGGGC
CGGTCGAGAAAATCATTCAGCTGATCGATCTGCAATTGCCGGGCGCTCGCTTGTTGCCGATGGCTTCGCC
GCCGCGGCACATACCGTATTACCCGAACAGCATCTATTTCGAGGTTGATCATGCCGACCCGATTTATAAG
GAAATGATGGCCGGCTCGGCGATGGCGCTCAGCATCGTGGGTGATTTCCCCGACCTGCGTTTTGACGTCT
GGGGATTAAGGCAAGGGAGGGTGGGATGA