SecReT6
Protein ID: 448242908
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31480
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3393404..3393910 [-]
Producthypothetical protein
NoteTssJ
UniProt IDL7ZP98
KEGG IDsmw:SMWW4_v1c31480
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-10, Aligned region: 18..135
Protein Sequence: 168 a.a.     [Download]
>gi|448242908|ref|YP_007406961.1| hypothetical protein SMWW4_v1c31480 [Serratia marcescens WW4]
MVKTLRGMATGGLLAVGMLGGCSWFSHDEAADAGRRLRFIDVEVTANDNVNPNAAGEAQPVKVCVIETNR
SGWMPEGIGDGAPCRETAPSEGALSRHQSILQPRETLRYRFEVPAGQERWVVVGAEFQQISGVLPLAEQK
SPAQADSQMKVMVGMTSLSIVTNDKMDE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3393910-3393404 Serratia marcescens WW4, complete genome
ATGGTGAAAACGCTCCGGGGGATGGCGACAGGGGGACTGTTGGCGGTGGGGATGCTCGGCGGATGCAGCT
GGTTTTCTCATGATGAGGCTGCGGATGCGGGGCGCCGGTTGCGGTTTATCGACGTCGAGGTGACCGCCAA
CGACAACGTGAACCCGAATGCCGCCGGGGAGGCGCAGCCGGTCAAGGTGTGCGTGATAGAAACCAATCGC
TCGGGGTGGATGCCCGAGGGGATTGGCGACGGTGCTCCTTGCCGCGAGACGGCGCCGTCGGAAGGGGCGC
TGAGCCGGCACCAGAGCATTTTGCAACCGAGGGAGACGTTGCGTTATCGCTTCGAGGTGCCGGCGGGGCA
AGAGCGATGGGTCGTCGTCGGGGCGGAGTTTCAGCAAATCAGCGGCGTGTTGCCGCTCGCCGAGCAAAAG
TCCCCTGCGCAGGCTGATTCGCAAATGAAGGTGATGGTGGGGATGACGTCACTCAGCATAGTGACTAACG
ACAAAATGGATGAATGA