SecReT6
Protein ID: 448242909
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31490
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3393920..3394285 [-]
Producthypothetical protein
NotePAAR
UniProt IDL7ZHD9
KEGG IDsmw:SMWW4_v1c31490
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 4.90E-18, Aligned region: 18..106
Protein Sequence: 121 a.a.     [Download]
>gi|448242909|ref|YP_007406962.1| hypothetical protein SMWW4_v1c31490 [Serratia marcescens WW4]
MTAANNNMAGISFAGCDPMIPVPGPNTAPNNTGIPNVPNCFLCGGNEQNLGSIRAATVDSGGVIGAASGT
HSAQMQPVQGSGKYFTGGMPVTRLGDSSTTNNNNMVATQVAPSQTKCFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3394285-3393920 Serratia marcescens WW4, complete genome
ATGACTGCAGCCAATAACAACATGGCCGGGATCAGCTTTGCCGGCTGTGACCCGATGATACCGGTGCCGG
GCCCGAACACTGCGCCCAACAACACCGGCATACCGAACGTGCCTAACTGTTTCCTTTGCGGCGGCAATGA
ACAGAACCTCGGCAGCATTCGCGCGGCCACCGTCGATTCGGGCGGGGTGATCGGCGCCGCCTCCGGGACG
CATTCGGCCCAGATGCAGCCGGTGCAGGGATCGGGCAAGTATTTCACCGGCGGCATGCCGGTCACGCGGC
TAGGCGATTCCAGCACGACGAACAATAACAACATGGTTGCCACTCAGGTCGCGCCCAGCCAGACCAAATG
TTTCGTTAATGCATAG