SecReT6
Protein ID: 448242913
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31530
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3398281..3400542 [-]
Producthypothetical protein
NoteTssI
UniProt IDL7ZPA5
KEGG IDsmw:SMWW4_v1c31530
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-67, Aligned region: 25..326
Phage_GPD [PF05954], Evalue: 9.80E-67, Aligned region: 590..590
Phage_base_V [PF04717], Evalue: 1.00E-23, Aligned region: 364..457
Protein Sequence: 753 a.a.     [Download]
>gi|448242913|ref|YP_007406966.1| hypothetical protein SMWW4_v1c31530 [Serratia marcescens WW4]
MPLIEIDNPVLAELNAFPLSFTTKEGLSSNSQYTLEFECEQADVDYESLLGQGISIQIERPDFGARPFYA
YVIGASDSGQHQDKFVYKLELSTWLWFLMQNRNSRIFQDLNVLDIIEQIFSRYGFADYRLDIQGTYPTRE
YCVQFSETDFAFISRLLEDEGIWYYFDHAEDKHTLVITDRQNFDDLDFGYAVLPFMPDSEENRAIREGIQ
RIQRSRKVRPNEIVLRDFDFQNPRKNLQTKVEESRLGLQNTPLEWYDYAAGYVDTERGENLARLRLEEMQ
SDGHLLFGESNAVGLMAGKDFSLILHPDANRNRRFKLTRCDYVFVQDGPDSSSDGRNVTCRFNALNDDVP
FRPLRETPKPQMPGIQSATVVGAPNSEVHTDKFARIRVHFHWDRYKTTEEDSSCWIRVVQAWAGKGWGVI
AMPRVGQEVLVTYVDGDLDRPMVTGIVYNGDNPPPYQLPEYINYSGMVSRSLRFGKPQHASQLTFDDNRN
NERVMLHAERDLQTTVERNQATEVGMDKFDIIRRTFTDWFTNHVSYKDYVFSITGFDASIKGVSASMTGV
SLTATGVSTSFTGVSTSFTGVSTSFTGVSTSFTGLSTSFTGQSTSCTGVSNSMTGESNSFTSISNSMTGE
SNSYTTVSTSQTGSSTSFTGVSVSTTGSSTSTTGCSISTTGSSTSTTGCSISTTGSSVSTTGSSVGTTGS
SVSSTGSSVSNTGSSVSNTGSSTSTTGVSISYTGASLSETGVDLKKVGMQSKN
 
Nucleotide Sequence: 2262 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3400542-3398281 Serratia marcescens WW4, complete genome
ATGCCTTTAATCGAAATTGATAACCCGGTGTTAGCCGAATTAAATGCGTTTCCACTCAGCTTCACCACCA
AAGAAGGGTTGTCGAGCAACTCGCAATATACGCTCGAATTCGAATGTGAACAGGCGGACGTTGATTATGA
ATCTCTGCTGGGTCAAGGGATCAGCATTCAAATAGAAAGGCCGGATTTCGGCGCGCGGCCGTTTTACGCT
TACGTGATCGGCGCCTCCGATTCGGGGCAGCATCAGGATAAGTTCGTTTATAAGCTGGAGCTGAGCACCT
GGCTGTGGTTTTTGATGCAAAACCGCAACAGCCGCATTTTCCAGGATTTGAACGTGCTCGACATCATCGA
GCAAATCTTCTCGCGCTACGGTTTTGCCGACTACCGTCTGGATATTCAAGGCACTTATCCGACGCGTGAA
TATTGCGTGCAGTTTTCCGAAACGGATTTCGCGTTTATCAGCCGCCTGCTGGAAGACGAAGGCATCTGGT
ATTACTTCGATCACGCCGAGGATAAACACACGCTGGTGATCACCGACCGGCAGAATTTCGACGATCTGGA
TTTCGGTTACGCCGTGTTGCCGTTCATGCCGGACAGCGAAGAAAACCGCGCCATCCGCGAAGGGATCCAG
CGCATCCAGCGCTCCCGCAAAGTGCGCCCGAATGAAATCGTGCTGCGCGACTTTGACTTCCAGAACCCGC
GCAAGAACCTGCAAACCAAGGTGGAAGAGAGCCGCCTCGGCCTGCAGAACACCCCGCTGGAGTGGTACGA
CTACGCGGCGGGTTATGTGGATACCGAACGCGGTGAAAACCTGGCGCGGCTGCGCCTGGAAGAAATGCAA
AGCGACGGCCATCTGCTGTTTGGCGAGAGCAACGCCGTCGGGCTGATGGCCGGCAAGGATTTCTCCTTGA
TTTTGCACCCGGACGCCAACCGCAACCGCCGCTTCAAGCTGACCCGTTGCGACTATGTGTTCGTGCAAGA
CGGCCCGGACAGCAGCAGCGACGGCCGCAACGTCACCTGCCGTTTCAATGCGTTGAACGACGACGTGCCG
TTCCGCCCGCTGCGCGAAACGCCAAAACCGCAGATGCCGGGCATCCAGAGCGCCACCGTGGTCGGCGCGC
CCAACTCCGAAGTGCATACCGACAAATTTGCGCGCATCCGCGTGCATTTCCACTGGGATCGCTACAAAAC
CACCGAGGAAGACAGCTCTTGCTGGATCCGCGTGGTGCAGGCCTGGGCGGGGAAAGGCTGGGGCGTGATC
GCCATGCCGCGCGTCGGCCAGGAAGTGCTGGTGACCTATGTCGACGGCGATCTCGATCGTCCGATGGTGA
CCGGGATTGTGTATAACGGCGACAACCCGCCGCCTTATCAGTTACCTGAATACATCAACTACTCGGGCAT
GGTGTCGCGTTCGCTGCGCTTCGGCAAGCCGCAGCATGCCAGCCAGTTGACCTTCGATGACAACCGCAAC
AACGAACGCGTCATGCTGCATGCCGAACGCGATCTGCAAACCACGGTGGAGCGCAACCAGGCCACCGAGG
TGGGAATGGACAAGTTCGACATCATCCGCCGCACCTTTACGGACTGGTTCACCAACCACGTCTCTTACAA
GGATTACGTCTTCAGCATTACCGGGTTTGACGCCTCGATTAAAGGCGTCAGCGCGTCGATGACCGGCGTC
AGCCTCACCGCCACCGGCGTGAGCACCTCGTTCACCGGCGTCAGCACCTCGTTCACCGGCGTGAGCACGT
CATTTACCGGCGTCAGCACTTCGTTCACCGGGCTGAGCACCTCGTTCACCGGGCAGAGCACCAGCTGCAC
CGGCGTATCAAACTCGATGACCGGCGAAAGCAACTCCTTCACCAGCATCAGCAACAGCATGACCGGCGAA
AGCAACAGCTACACCACGGTCAGCACCAGCCAGACCGGCAGCAGCACCAGCTTTACCGGCGTCAGCGTCA
GCACCACCGGATCGTCGACCAGCACCACCGGCTGCAGCATCAGCACCACCGGATCGTCGACCAGCACCAC
CGGCTGCAGCATCAGCACCACCGGCAGCAGCGTGAGCACCACCGGCAGCAGCGTCGGCACCACCGGCAGC
AGCGTCAGCAGCACCGGCAGCAGCGTCAGCAACACCGGCAGCAGCGTCAGCAATACCGGCAGCAGCACCA
GCACGACAGGGGTGTCGATCAGCTATACCGGCGCGTCACTGTCCGAGACCGGCGTCGATTTGAAAAAAGT
CGGGATGCAAAGCAAAAACTAA