SecReT6
Protein ID: 448242914
SecReT6 ID731
T6SS typei3
Gene symbolclpV
Locus tagSMWW4_v1c31540
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3400607..3403192 [-]
Producttype VI secretion ATPase, ClpV family
NoteTssH
UniProt IDL7ZHE4
KEGG IDsmw:SMWW4_v1c31540
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-36, Aligned region: 224..243
AAA_2 [PF07724], Evalue: 1.10E-36, Aligned region: 468..505
AAA_2 [PF07724], Evalue: 1.10E-36, Aligned region: 594..761
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 225..356
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 600..684
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 225..247
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 599..704
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 269..304
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 469..489
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 569..621
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 665..690
ClpB_D2-small [PF10431], Evalue: 1.90E-09, Aligned region: 766..838
Clp_N [PF02861], Evalue: 1.50E-08, Aligned region: 22..73
Clp_N [PF02861], Evalue: 1.50E-08, Aligned region: 113..128
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 224..338
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 598..618
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 659..687
AAA_17 [PF13207], Evalue: 2.50E-07, Aligned region: 167..219
AAA_17 [PF13207], Evalue: 2.50E-07, Aligned region: 225..263
AAA_17 [PF13207], Evalue: 2.50E-07, Aligned region: 599..635
IstB_IS21 [PF01695], Evalue: 8.30E-07, Aligned region: 216..248
IstB_IS21 [PF01695], Evalue: 8.30E-07, Aligned region: 599..620
Sigma54_activat [PF00158], Evalue: 8.80E-07, Aligned region: 204..243
Sigma54_activat [PF00158], Evalue: 8.80E-07, Aligned region: 599..699
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 131..174
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 204..238
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 277..376
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 598..637
AAA_18 [PF13238], Evalue: 7.50E-06, Aligned region: 131..193
AAA_18 [PF13238], Evalue: 7.50E-06, Aligned region: 225..244
AAA_18 [PF13238], Evalue: 7.50E-06, Aligned region: 601..625
AAA_25 [PF13481], Evalue: 9.90E-06, Aligned region: 208..250
AAA_25 [PF13481], Evalue: 9.90E-06, Aligned region: 597..624
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 222..246
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 591..621
NACHT [PF05729], Evalue: 2.70E-05, Aligned region: 225..252
NACHT [PF05729], Evalue: 2.70E-05, Aligned region: 415..456
NACHT [PF05729], Evalue: 2.70E-05, Aligned region: 599..639
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 225..248
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 598..639
RNA_helicase [PF00910], Evalue: 0.00053, Aligned region: 226..247
RNA_helicase [PF00910], Evalue: 0.00053, Aligned region: 600..621
RNA_helicase [PF00910], Evalue: 0.00053, Aligned region: 697..717
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 217..241
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 597..631
ResIII [PF04851], Evalue: 0.0013, Aligned region: 213..245
ResIII [PF04851], Evalue: 0.0013, Aligned region: 296..307
ResIII [PF04851], Evalue: 0.0013, Aligned region: 571..625
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 224..245
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 564..621
PhoH [PF02562], Evalue: 0.0054, Aligned region: 210..246
PhoH [PF02562], Evalue: 0.0054, Aligned region: 302..315
PhoH [PF02562], Evalue: 0.0054, Aligned region: 598..620
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 225..253
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 598..624
DEAD [PF00270], Evalue: 0.01, Aligned region: 211..389
DEAD [PF00270], Evalue: 0.01, Aligned region: 598..618
DEAD [PF00270], Evalue: 0.01, Aligned region: 667..683
TIP49 [PF06068], Evalue: 0.01, Aligned region: 225..265
TIP49 [PF06068], Evalue: 0.01, Aligned region: 272..305
TIP49 [PF06068], Evalue: 0.01, Aligned region: 598..634
Protein Sequence: 861 a.a.     [Download]
>gi|448242914|ref|YP_007406967.1| type VI secretion ATPase, ClpV family [Serratia marcescens WW4]
MYQRERLFSRLGHFAYQSFVEATKLCRTFRHEYVELEHWLKVLVDKERGDLPLILAHYAINSQRISDALD
RILHTLPNRTNAVVDLSTQLETVVERGLLMSQLAETPSGGVRTIHILVGILQDPTLQRSLYRLSDEFKKL
PIPQLFDDYPAILAESVEHEEEEEEVYSAHGDAPEASETVDILDKWCADLTRQARDGEIDPVIGREAELR
QVIDILLRRRQNNPILVGEAGVGKTAVAEALACKIAQGQVPPLLQGARLLSLDLGRMQAGASMRGEFESR
LKALIDAIAHSAVPVILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMVAATTWSEYKQFIEPDAA
LTRRFQYVLVSEPDEENAVNMMRAIAPHFAQHHSVKIRESALQAAVHLSLRHLPSRQLPDKAISLLDTAC
ARVALSQHALPEKIESLEAGLAVKRTEMNGLQEESKFDDLALSRITELQQTLSDMEGELAALRQRQAQEQ
QAVTTLLDAERQSPERLPQLASELGALQDGGLPLVYPWVDDRVVAEVLSDWTGIPTGRMLQSDLDNALNL
NQLLSRQIFGQQTAIDEIAQAVRISRAGIQAHDRPLGVFMLSGPSGVGKTETAFALAEAMYGGAHNLIVF
NMSEFQESHTVSTLKGAPPGYVGYGKGGKLTEAVRRKPYSIVLLDEFDKAHPDIHEAFYQVFDKGVMEDG
EGRMISFRQCFILMTSNIGAGEIEATLAETPDLKTEALRPMLHDVLARFFPAALLARMNVIPYVPLSTEA
ITHIATKQISRLQQRLHKEVGVSLVLEGDIPGWIAKRISAHPSRGRAVESLLQQAILPPISNEVLQRKRT
GQELQNIQLMVENDSLSVYFD
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3403192-3400607 Serratia marcescens WW4, complete genome
GTGTATCAACGAGAACGTCTTTTTTCGCGATTGGGCCACTTTGCCTATCAGTCGTTCGTCGAAGCGACCA
AGCTGTGCCGAACCTTCAGGCACGAATACGTGGAGCTGGAACACTGGCTGAAAGTCCTGGTGGACAAGGA
GCGCGGCGACCTGCCGCTGATCCTGGCGCACTACGCCATCAACAGTCAGCGCATCAGCGATGCGTTGGAT
CGCATTCTTCATACCTTGCCGAACCGCACGAATGCGGTGGTGGATCTGTCGACGCAACTGGAAACGGTGG
TGGAAAGAGGGCTGCTGATGAGCCAGCTCGCCGAAACGCCGTCCGGCGGGGTGCGCACCATTCATATCCT
GGTCGGCATTCTGCAGGATCCCACGTTGCAGCGCAGCCTGTACCGGCTGAGCGACGAGTTCAAAAAACTG
CCGATCCCGCAGCTGTTCGACGATTATCCGGCGATTCTGGCGGAGTCCGTCGAGCATGAGGAAGAGGAAG
AAGAGGTCTACAGCGCCCACGGCGATGCGCCGGAGGCGTCCGAGACGGTCGATATTCTCGATAAATGGTG
CGCCGATCTGACCCGCCAGGCGCGCGACGGTGAAATCGACCCGGTGATTGGCCGCGAAGCGGAGCTGCGC
CAGGTGATCGACATCTTGCTGCGTCGCCGGCAGAACAACCCGATTTTGGTGGGCGAAGCCGGGGTCGGCA
AAACGGCGGTGGCGGAAGCGCTGGCCTGCAAGATAGCCCAGGGGCAGGTGCCGCCGCTGCTGCAGGGCGC
CCGGCTGCTGTCTTTGGATCTGGGGCGCATGCAGGCCGGGGCGAGCATGAGGGGCGAATTCGAATCGCGC
CTGAAAGCGCTGATCGACGCCATCGCGCATTCGGCGGTGCCGGTGATCCTGTTTTGCGACGAGGCGCATA
CGCTGGTGGGCGCCGGCGGGCAGGCCGGCACCGGCGACGCCGTCAACCTGTTGAAACCGATGCTGGCCAG
GGGGGCGCTGCGCATGGTGGCGGCGACGACCTGGTCGGAATACAAACAGTTCATCGAGCCGGACGCCGCG
CTGACGCGCCGTTTCCAGTACGTGTTGGTTTCTGAACCCGACGAAGAGAATGCGGTGAACATGATGCGCG
CCATCGCCCCGCATTTTGCGCAGCACCACAGCGTCAAGATCCGCGAGTCGGCGCTGCAGGCGGCGGTGCA
TTTGTCGCTGCGCCATCTGCCGTCGCGGCAACTGCCGGACAAAGCCATCAGCTTGCTGGACACCGCCTGC
GCGCGGGTGGCGCTGAGCCAGCATGCGCTGCCTGAAAAAATCGAGTCGCTCGAGGCCGGGTTGGCGGTGA
AGCGCACCGAAATGAACGGCCTGCAGGAGGAAAGCAAATTCGACGATCTGGCGCTCAGCCGCATCACTGA
ATTGCAGCAGACCCTCAGCGATATGGAAGGCGAACTGGCTGCGCTGCGTCAGCGGCAGGCGCAGGAGCAA
CAGGCGGTCACCACCTTGCTCGACGCGGAGCGGCAGTCGCCGGAGCGCTTGCCGCAGTTGGCCTCCGAAC
TGGGAGCCTTGCAAGACGGCGGCCTGCCGTTGGTGTATCCGTGGGTGGATGACCGCGTCGTGGCGGAGGT
GTTGTCGGATTGGACCGGCATCCCCACCGGCCGCATGCTGCAAAGCGATCTGGACAATGCGCTCAATCTC
AATCAACTGCTGAGCCGCCAGATATTCGGCCAGCAGACGGCGATCGATGAAATCGCGCAGGCGGTGCGCA
TCTCCCGCGCCGGCATTCAGGCGCACGATCGGCCATTGGGCGTTTTCATGCTGTCCGGCCCGAGTGGCGT
CGGCAAAACGGAGACCGCGTTTGCGCTGGCGGAGGCGATGTACGGCGGCGCGCACAACCTGATCGTCTTC
AATATGAGCGAGTTTCAGGAATCGCATACCGTTTCCACCCTGAAAGGGGCGCCACCGGGCTATGTCGGCT
ACGGCAAGGGCGGCAAGTTGACCGAGGCGGTGCGCCGCAAACCTTATTCCATCGTCTTGCTCGACGAATT
CGACAAGGCGCATCCCGATATCCACGAGGCGTTTTATCAAGTCTTCGACAAGGGCGTGATGGAAGACGGT
GAGGGCCGCATGATCAGCTTCCGCCAGTGTTTCATTTTAATGACGAGCAATATCGGCGCCGGCGAAATAG
AAGCGACGCTGGCGGAAACGCCGGATCTGAAAACCGAAGCGCTGCGGCCGATGCTGCACGACGTGCTGGC
GCGCTTCTTCCCGGCGGCGCTGTTGGCGCGCATGAACGTCATTCCCTACGTGCCGCTTTCTACCGAAGCG
ATAACCCATATCGCCACCAAACAGATTTCGCGTTTACAACAGCGTTTGCACAAAGAAGTGGGCGTGTCGC
TGGTGCTGGAAGGCGACATTCCAGGCTGGATAGCCAAACGCATCAGCGCCCATCCTTCGCGCGGCAGAGC
GGTCGAGTCGCTGCTGCAGCAGGCGATTTTGCCGCCCATCAGCAATGAAGTGCTGCAGCGCAAACGGACG
GGACAGGAACTGCAGAATATCCAACTCATGGTCGAGAACGATAGTTTAAGTGTTTATTTCGACTGA