SecReT6
Protein ID: 448242915
SecReT6 ID731
T6SS typei3
Gene symboltssG
Locus tagSMWW4_v1c31550
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3403209..3404237 [-]
Producttype VI secretion protein, TssG family
NoteTssG
UniProt IDL7ZP17
KEGG IDsmw:SMWW4_v1c31550
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.70E-62, Aligned region: 37..327
Protein Sequence: 342 a.a.     [Download]
>gi|448242915|ref|YP_007406968.1| type VI secretion protein, TssG family [Serratia marcescens WW4]
MADMSLMRETALSLEQAPTPGAQSESAGQAEIRGLSNRQDFFELLRRIERAQPDAPRLGVSNDRSRERLC
ITQPADMAFASREIASIVQRPKQVLIQARHFGMFAPYGPLPIHVTEHARTEVIARRNQAFQQFVGIVSQR
FAVLHYRAWAQLKAMIGHEHDDDKNPFLRHLRQTVGVDTALTVNPHIQRLREAYPGTYLPGRRSLRQLNK
MLAAYFAVPITITPRYAKWIDDGKQSGSQKLGKLGSTRIGSRFFDAQYGAHIQIGPLGAPQYQQYQRGSR
RLQALVSICHDFTSHQLMLDVSLLIATEPGMAAQLGGKSLSKDSWLKPKTGTFRQLVYQSTT
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3404237-3403209 Serratia marcescens WW4, complete genome
ATGGCTGATATGTCGTTGATGCGTGAAACGGCGCTCTCGTTGGAACAGGCGCCGACGCCGGGGGCGCAAA
GCGAAAGCGCGGGCCAGGCCGAAATCCGCGGGCTGTCCAATCGACAGGATTTTTTCGAGCTGCTGCGGCG
TATCGAACGCGCGCAGCCGGATGCGCCGCGGCTCGGCGTCTCCAACGATCGCAGCCGCGAAAGGCTCTGC
ATTACCCAGCCGGCGGATATGGCGTTCGCTTCGCGTGAAATCGCCTCTATCGTGCAGCGCCCTAAGCAAG
TGCTGATCCAGGCGCGGCATTTCGGCATGTTCGCCCCCTACGGCCCGCTGCCGATCCATGTGACCGAGCA
CGCGCGCACCGAAGTCATCGCCAGACGCAACCAGGCGTTCCAGCAGTTCGTCGGCATCGTCAGCCAGCGC
TTCGCCGTATTGCACTACCGGGCCTGGGCGCAGCTGAAGGCGATGATCGGCCATGAGCATGACGATGACA
AAAACCCGTTCTTGCGCCATTTGCGCCAGACGGTGGGCGTCGATACGGCGCTGACGGTGAACCCGCATAT
CCAGCGCCTGCGCGAGGCGTACCCCGGCACTTATCTGCCCGGTCGCCGCTCGCTGCGGCAGCTCAACAAG
ATGTTGGCGGCCTATTTCGCCGTTCCCATCACGATTACGCCGCGCTACGCCAAGTGGATCGACGACGGCA
AGCAAAGCGGCAGCCAAAAGCTGGGCAAGTTGGGCAGCACGCGCATCGGCAGCCGCTTTTTCGATGCCCA
GTACGGCGCGCATATTCAGATCGGCCCGCTGGGGGCCCCGCAGTATCAGCAGTATCAGCGCGGCAGCCGG
CGGCTGCAGGCGCTGGTGAGCATCTGTCATGACTTTACGAGCCATCAGTTGATGCTGGATGTCAGCCTGC
TGATCGCCACGGAGCCGGGCATGGCGGCGCAGCTGGGCGGCAAGTCGCTGAGTAAAGACAGCTGGCTGAA
ACCTAAGACAGGGACGTTTAGGCAGCTGGTTTATCAATCAACAACTTAA