SecReT6
Protein ID: 448242916
SecReT6 ID731
T6SS typei3
Gene symboltssF
Locus tagSMWW4_v1c31560
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3404230..3406071 [-]
Producttype VI secretion protein, TssF family
NoteTssF
UniProt IDL7ZMS8
KEGG IDsmw:SMWW4_v1c31560
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-142, Aligned region: 6..604
Protein Sequence: 613 a.a.     [Download]
>gi|448242916|ref|YP_007406969.1| type VI secretion protein, TssF family [Serratia marcescens WW4]
MFSERFLQLYNDELRYFREAGRQFASSHPQVAQHLGMHIDGVLDPFVERLLEGSAFLCTRIQEKLNNEQP
EFALQMLSRLAPLWYTPVPAIATVAIKPDLSFPQWHSQVDLPRGSRMTLNDISLNNKPATFTTARHIKVQ
PVEISLAECEILPPHHLPDGAARHMQDCSAYVRICLTTHGVLPVSELDLEPLHLTLAEDTVRANQLLAAL
LNRTLRIVLWAKSDDRPIVKVLPPGSLRLGGVSDEEALLPTVVGELPGNRLMREYFAAPSRFFSLELHGV
QDFLRQCERVHEFEILFALEQRPLTLIGRVNARDFHLFATPVINLYRRHCSPVLLTDERTEHQLVVDRLN
TSLYEIHSVKQVKGMLPDGNPVIFSSLQADVQYDCEREPAGYTLHRRREPSPSKYNNPHLPNEDTFIAIS
PGKSGIDIDDITSLSVEALVCERHLVPAHLQQPHFQLETAMPIHQVEIVRYPSNPVAVPNISQAWQAIQM
LASNPLRHARPDVQDCSALLRDWLSLFCHQDDSSQRKRIASIKNAWVEHHFERNQGPGPLAWIRGAEIAV
NLSANHHADHGAYLFGKILHHALSQYGDLNQTLSMKLLLDGETHADWGALYYG
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3406071-3404230 Serratia marcescens WW4, complete genome
ATGTTCAGTGAGCGCTTTCTCCAATTATATAATGATGAGCTGCGTTATTTTCGCGAGGCCGGTCGTCAGT
TCGCCTCTTCTCATCCCCAGGTCGCCCAGCATTTAGGCATGCATATCGACGGCGTGCTGGATCCTTTCGT
TGAGCGTCTGTTGGAGGGCTCCGCGTTCCTTTGCACCCGCATCCAGGAAAAGCTGAACAATGAGCAGCCG
GAATTTGCCTTGCAAATGCTCTCACGCCTGGCGCCGCTGTGGTATACGCCGGTTCCCGCAATCGCCACCG
TCGCGATTAAGCCCGATCTCTCTTTTCCCCAGTGGCACAGCCAGGTTGACCTGCCGCGCGGGAGCCGCAT
GACCCTCAACGATATCTCGCTGAACAACAAACCCGCCACGTTCACCACGGCGCGGCATATTAAAGTGCAG
CCCGTTGAGATTTCACTGGCGGAATGCGAGATTTTGCCGCCGCACCATTTGCCTGACGGCGCCGCCAGAC
ACATGCAGGATTGCTCGGCCTACGTCAGGATATGCCTGACGACGCACGGCGTGCTTCCCGTCTCGGAGCT
GGATCTCGAGCCGCTGCACCTGACGCTGGCGGAAGATACGGTGCGGGCCAATCAACTGCTGGCCGCGTTG
CTTAATCGCACCTTGCGCATCGTGCTATGGGCGAAAAGCGACGACCGGCCAATCGTCAAAGTCTTGCCGC
CGGGCAGCTTGCGCCTGGGCGGCGTCAGCGATGAAGAAGCCTTGTTGCCCACCGTGGTGGGGGAATTGCC
CGGCAACCGGCTGATGCGTGAATACTTCGCCGCGCCAAGCCGCTTCTTCAGCCTGGAGTTGCATGGCGTG
CAGGATTTTCTGCGCCAATGTGAACGCGTTCACGAGTTCGAGATCTTGTTCGCGCTGGAGCAACGCCCAC
TCACTCTGATCGGTCGCGTCAACGCCAGGGATTTTCATCTTTTCGCGACCCCGGTCATCAACCTGTATCG
CCGCCATTGCTCGCCGGTGCTGCTGACGGATGAGCGCACGGAGCACCAGCTGGTGGTCGATCGTTTGAAC
ACCTCGCTGTATGAGATACACAGCGTAAAACAGGTGAAAGGCATGCTGCCCGACGGCAACCCGGTGATTT
TCTCTTCGCTGCAGGCCGACGTGCAGTACGACTGCGAGCGGGAGCCGGCCGGTTATACGCTGCACCGTCG
CCGGGAGCCGTCGCCCTCCAAGTACAACAATCCGCACCTGCCCAACGAAGATACCTTCATCGCCATCTCG
CCGGGCAAAAGCGGCATCGACATCGACGACATCACGTCGCTCAGCGTCGAGGCGCTGGTCTGCGAACGGC
ATCTGGTGCCGGCGCACCTTCAGCAGCCGCATTTCCAGCTGGAAACGGCGATGCCGATCCACCAGGTGGA
GATCGTCCGCTACCCGAGCAACCCGGTCGCGGTGCCGAACATCAGCCAGGCGTGGCAGGCGATTCAGATG
CTGGCCTCCAATCCTCTGCGCCATGCGCGCCCCGACGTTCAGGATTGTTCGGCGCTGTTGCGCGACTGGC
TGTCGTTGTTCTGCCATCAGGATGACTCCAGCCAGCGCAAGCGCATCGCCAGCATCAAAAATGCCTGGGT
GGAGCACCACTTCGAACGCAATCAGGGGCCGGGGCCGCTGGCCTGGATCCGCGGAGCCGAGATCGCCGTC
AACTTAAGCGCCAACCATCATGCCGACCACGGCGCCTATCTGTTCGGCAAAATATTGCACCACGCGTTGA
GCCAATACGGCGACCTGAACCAAACGTTAAGCATGAAGCTGTTGCTGGATGGGGAAACCCACGCCGACTG
GGGGGCGCTCTACTATGGCTGA