SecReT6
Protein ID: 448242917
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31570
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3406083..3406529 [-]
Producthypothetical protein
NoteTssE
UniProt IDL7ZQM3
KEGG IDsmw:SMWW4_v1c31570
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-14, Aligned region: 21..121
Protein Sequence: 148 a.a.     [Download]
>gi|448242917|ref|YP_007406970.1| hypothetical protein SMWW4_v1c31570 [Serratia marcescens WW4]
MKASLPMLFDKLSVRHQSASADNWRRVLVRDIEFLLNDASRSADLKLHDYAHSESSVLNYGLPSLSQRIP
INTDPLTLARHIQRIITSFEPRLDPKTIRVVPVVNERQSYVLAILFDIYGTCSLPGDEMLVNLRIALDYS
CGAVHVFD
 
Nucleotide Sequence: 447 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3406529-3406083 Serratia marcescens WW4, complete genome
ATGAAAGCGTCATTGCCCATGCTATTCGATAAGCTCAGCGTGAGACATCAAAGCGCCAGCGCCGATAATT
GGCGGCGTGTTTTGGTGCGTGATATCGAATTTTTACTGAATGACGCATCGCGCAGCGCTGATTTGAAACT
TCATGATTATGCGCACAGCGAAAGTTCGGTATTGAATTATGGCCTGCCGTCGCTGAGCCAACGCATACCG
ATTAATACCGATCCGTTAACGCTGGCGAGACATATACAAAGAATCATTACTTCGTTTGAGCCGCGTCTGG
ATCCGAAAACGATTCGTGTGGTGCCTGTAGTGAATGAACGCCAATCGTATGTGCTGGCGATTTTATTCGA
TATTTATGGCACCTGCTCATTACCGGGTGACGAAATGCTGGTTAATTTGCGCATCGCTCTTGATTATTCC
TGTGGCGCCGTACACGTATTTGATTAA