SecReT6
Protein ID: 448242919
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31590
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3407367..3408893 [-]
Producthypothetical protein
NoteTssC
UniProt IDL7ZHE9
KEGG IDsmw:SMWW4_v1c31590
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.50E-184, Aligned region: 74..500
Protein Sequence: 508 a.a.     [Download]
>gi|448242919|ref|YP_007406972.1| hypothetical protein SMWW4_v1c31590 [Serratia marcescens WW4]
MRARQRRYSAKQQATAVAEVETQDTENELDGLLKRSFRPRTNEASEAVRRAIGTLSEYANKGKVKVSQDV
VLTIESLIAQIDEQLSQQMNNILHHKEFQKLESAWQGLSYLVDNTNVSETLKIRVLNISQDELTRNLRRY
RGSAWDQSPVFKQIYEQEYGQFGGEPFGCIIGDFEFDHSPMSVTLLTELAKISAASHCPFISAASPSLLQ
MSKWNELGNPRDIGKIFTTPEYASWRRLRESNDSRYLVLTMPRFLSRLPYGAKTNPIEEFAFEESVRPDV
DDDFSWANSAYAMGVNINRAFHEYGWCSKIRGIESGGSVEELPAYAFPSDEGGYELTCPTEVAISDRREQ
ELSDAGFLPLVYRKHSDFAAFIGSCTMHAPAKYEDPDATANAKLSSRLPYIFATCRFAHYLKCIVRDKIG
SFRSRDDMQLWLNDWLMNYVDGDPSVSTEATKARRPLAAAEVRVEDVEDDPGYYRAHFYLRPHYQLEGMT
VSLRLVSKLPSAKKDGSR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3408893-3407367 Serratia marcescens WW4, complete genome
ATGAGAGCGAGGCAACGACGCTATTCGGCTAAGCAGCAGGCTACGGCAGTCGCTGAAGTTGAAACGCAGG
ACACGGAAAATGAGCTTGACGGTTTGCTCAAGCGTTCATTCCGGCCCAGAACGAACGAGGCTTCGGAAGC
GGTTCGTCGGGCTATCGGCACGCTGTCCGAATATGCCAACAAAGGCAAGGTCAAGGTCAGCCAGGATGTC
GTATTGACCATTGAATCGTTGATTGCCCAGATCGACGAACAGCTTTCGCAACAGATGAACAATATCTTGC
ACCACAAGGAGTTCCAGAAGCTGGAGTCCGCCTGGCAAGGTCTGAGTTATCTGGTCGATAACACCAACGT
CAGCGAAACGCTCAAGATCCGGGTGTTGAACATCAGTCAGGATGAGCTGACGCGCAATTTGCGCCGCTAT
CGGGGCTCCGCCTGGGATCAAAGCCCGGTGTTCAAACAGATTTACGAACAGGAATATGGTCAGTTCGGCG
GCGAGCCGTTCGGTTGCATCATCGGCGATTTTGAATTCGATCACAGCCCGATGAGCGTCACGCTGCTGAC
CGAGTTGGCGAAAATTTCCGCGGCGTCGCACTGCCCGTTCATTTCCGCCGCGTCGCCGTCGCTGCTGCAG
ATGAGCAAGTGGAACGAACTGGGCAACCCGCGGGATATCGGCAAGATTTTCACCACGCCGGAATATGCGT
CCTGGCGCCGCCTGCGCGAAAGCAACGACTCGCGTTACCTGGTGTTGACGATGCCGCGTTTCCTGTCGCG
TTTGCCTTACGGGGCGAAAACCAACCCGATCGAAGAGTTCGCTTTCGAGGAGTCCGTCAGGCCGGATGTG
GATGATGATTTTTCCTGGGCCAACTCGGCGTATGCGATGGGCGTCAACATCAACCGCGCGTTCCATGAGT
ACGGCTGGTGTTCGAAGATTCGCGGCATCGAATCCGGCGGCTCGGTGGAAGAACTGCCCGCCTACGCGTT
TCCTTCCGATGAGGGCGGATATGAACTGACGTGCCCGACGGAAGTGGCCATTTCCGATCGGCGCGAGCAA
GAGCTTTCCGACGCCGGGTTCTTGCCCCTGGTCTATCGCAAGCATTCCGATTTCGCCGCTTTTATCGGTT
CTTGCACCATGCACGCGCCGGCGAAATACGAGGATCCCGACGCGACGGCCAACGCCAAGCTGTCTTCGCG
CTTGCCTTATATTTTCGCCACGTGCCGATTCGCGCACTATTTGAAATGCATCGTGCGCGACAAAATCGGT
TCTTTCCGTTCCAGAGACGATATGCAGCTGTGGCTGAATGACTGGCTGATGAACTACGTCGATGGCGATC
CTTCCGTATCGACCGAGGCGACCAAGGCGCGTCGTCCATTAGCCGCCGCCGAGGTGCGCGTTGAGGATGT
GGAAGACGATCCGGGTTATTACCGCGCGCATTTCTATTTGCGCCCGCATTACCAGTTGGAAGGCATGACC
GTGTCCTTGCGACTTGTATCAAAACTTCCGTCAGCCAAAAAAGATGGGAGCAGATAA