SecReT6
Protein ID: 448242920
SecReT6 ID731
T6SS typei3
Gene symboltssB
Locus tagSMWW4_v1c31600
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3408890..3409447 [-]
Producttype VI secretion protein, TssB family
NoteTssB
UniProt IDL7ZP21
KEGG IDsmw:SMWW4_v1c31600
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-57, Aligned region: 11..165
Protein Sequence: 185 a.a.     [Download]
>gi|448242920|ref|YP_007406973.1| type VI secretion protein, TssB family [Serratia marcescens WW4]
MAKDSSSQKFIGKNNAPRVQIEYDVELYGSQKKVELPFVTGVMSDLSGHRKKPLLPIEERKFLTFDQDNF
NDRMRAIKPRLQFYVENTLSEDDALLDVELEFESMDDFTPGAIAKRVPQMQRLLEAREHLTELITYMDGK
SSAEEVVKNLLEKPDFLHRLVTDARKTVADAEQDVQDPGNKGDEE
 
Nucleotide Sequence: 558 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3409447-3408890 Serratia marcescens WW4, complete genome
ATGGCTAAGGACTCAAGCTCTCAGAAATTTATCGGTAAAAATAACGCGCCGCGCGTGCAAATTGAATATG
ACGTAGAGCTTTACGGTTCACAAAAGAAAGTGGAGTTGCCCTTTGTTACGGGGGTCATGTCCGATCTCTC
TGGGCATCGGAAAAAGCCTTTGCTGCCGATCGAAGAGCGGAAATTCCTGACCTTTGATCAGGACAACTTC
AACGATCGCATGCGCGCCATCAAGCCTCGTCTGCAATTTTACGTAGAGAACACCCTGAGCGAAGACGATG
CGTTGCTGGACGTGGAATTGGAGTTTGAATCGATGGATGACTTCACGCCTGGCGCCATCGCCAAACGGGT
TCCGCAGATGCAACGCCTGCTTGAAGCCCGGGAGCATCTCACGGAGCTGATCACCTATATGGATGGTAAA
TCCAGCGCGGAAGAAGTGGTGAAGAATCTGCTGGAGAAACCCGATTTTCTGCATCGTTTGGTGACGGATG
CGCGTAAAACGGTCGCGGATGCGGAACAGGATGTGCAGGATCCCGGCAATAAAGGAGATGAGGAATGA