SecReT6
Protein ID: 448242921
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31610
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3409472..3410437 [-]
ProductImpA domain protein
NoteTssA
UniProt IDL7ZMT3
KEGG IDsmw:SMWW4_v1c31610
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-08, Aligned region: 45..104
Protein Sequence: 321 a.a.     [Download]
>gi|448242921|ref|YP_007406974.1| ImpA domain protein [Serratia marcescens WW4]
MNEVISTEVNGVEFDPRYSEIEFTLSEYDSQTDPLNAVDNARDINWHAIREQSAALLEQCFDLHVVLWFM
RANLHIDGFSAFYQGIKDIDAKYAEEGATIFPQADMEPSSDSFHAAALGWLATSSCLHEIKNSKIFPDTP
LTTDELLNMRLDEQEGKSLHFSEVVKVLGQADSYFAGRNLPSLKEQLALEIDALERVENYANLQAEDYRL
DCRQVRDYLKQFSRQLASLEQQELPAERDDAEIDSPDADAPVAMPGKYIRSRQDVILLLDQVLDYFQNYE
PSHPAPILIRRSQKMIGMDFATIVEELLPESLASLNQLSGK
 
Nucleotide Sequence: 966 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3410437-3409472 Serratia marcescens WW4, complete genome
ATGAATGAAGTCATCTCAACGGAAGTGAATGGCGTCGAATTTGATCCACGATACAGTGAAATTGAATTCA
CGCTTTCGGAATATGACAGTCAAACCGATCCGCTTAATGCCGTAGACAATGCGCGTGATATTAATTGGCA
CGCCATTCGCGAGCAGTCTGCCGCGTTGCTGGAACAGTGCTTCGATTTACATGTCGTGCTGTGGTTTATG
CGCGCCAATCTTCATATCGACGGTTTTTCGGCCTTCTACCAGGGCATTAAGGATATTGACGCCAAATATG
CCGAGGAGGGCGCCACCATTTTCCCTCAGGCGGACATGGAACCCTCATCGGACAGCTTTCATGCGGCCGC
ATTAGGGTGGCTCGCCACATCGTCCTGTCTGCACGAAATCAAGAACAGCAAGATTTTTCCCGACACGCCG
TTAACCACCGACGAGCTGCTGAATATGCGGCTTGACGAGCAGGAAGGCAAAAGCCTGCATTTTTCAGAGG
TGGTAAAGGTGCTGGGGCAAGCCGACAGTTATTTTGCCGGCAGAAATCTGCCTTCGCTGAAAGAGCAATT
GGCGCTGGAAATCGATGCGCTGGAGCGCGTCGAGAATTACGCCAATCTGCAGGCTGAAGATTATCGTTTG
GACTGCCGGCAGGTACGCGACTATTTGAAACAGTTCAGCCGCCAGCTGGCTTCACTGGAACAGCAGGAAT
TGCCGGCTGAACGGGATGACGCGGAGATTGACTCGCCGGATGCTGACGCGCCTGTCGCCATGCCCGGCAA
ATATATCCGTTCCCGGCAGGATGTCATCTTGCTGTTGGATCAGGTTTTGGACTATTTCCAAAACTATGAG
CCCAGCCATCCGGCCCCCATTCTTATTCGACGTTCACAAAAAATGATCGGTATGGACTTCGCGACGATTG
TTGAGGAGCTTTTGCCGGAATCTCTGGCCTCGTTAAATCAATTGTCCGGGAAGTAA