SecReT6
Protein ID: 449306486
SecReT6 ID734
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_20803
StrainCronobacter sakazakii Sp291
Repliconplasmid pSP291-1 [GenBank: NC_020263] [Browse all T6SS(s) in this replicon]
Location [Strand]53614..55155 [+]
Producthypothetical protein
NoteTssC
UniProt IDM1K0Y6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.40E-174, Aligned region: 88..509
DUF3508 [PF12018], Evalue: 0.0035, Aligned region: 63..142
Protein Sequence: 513 a.a.     [Download]
>gi|449306486|ref|YP_007443026.1| hypothetical protein CSSP291_20803 [Cronobacter sakazakii SP291]
MLMSVQNTPTAAGATQVQETTGGVYASLFEKINLHPVDALDDIDAWQDSQRLADASADERVTAAVRVFLE
RLKQSGQQVEKLDKTLLDHHIAELDRQISRQLDTVMHHPEFQQVESLWRGLKHLVDRTDYRQNVRTEILD
IAKEDLRQDFEDAPEIVQSGLYWHTYTAEYDTPGGEPVGAVISSYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPKFFLKDTMEEVAAIKDIGNYFDRAEYIKWKAFRDTDDARYIGLTLPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTSASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPEATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVRLYAV
PHFQVEGMDVSLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|449306428|ref|NC_020263.1|:53614-55155 Cronobacter sakazakii Sp291 plasmid pSP291-1, complete sequence
ATGCTGATGTCTGTTCAGAACACCCCCACTGCTGCCGGCGCCACGCAGGTGCAGGAAACCACCGGCGGCG
TCTACGCCTCGCTGTTTGAAAAAATTAATCTTCACCCGGTCGACGCGCTTGATGATATCGACGCCTGGCA
GGACAGCCAGCGCCTGGCGGACGCCTCCGCCGATGAACGCGTGACCGCCGCGGTCCGGGTTTTCCTGGAG
CGCCTGAAGCAGTCCGGCCAGCAGGTTGAAAAGCTCGACAAAACGCTGCTTGACCACCATATCGCTGAGC
TGGACCGGCAAATCAGCCGCCAGCTGGATACGGTGATGCACCATCCGGAGTTTCAGCAGGTGGAATCGCT
GTGGCGCGGCCTGAAGCATCTGGTGGATCGCACCGATTACCGCCAGAACGTGCGCACGGAAATTCTCGAT
ATCGCCAAAGAGGATTTGCGCCAGGACTTCGAGGACGCGCCGGAAATCGTCCAGAGCGGCCTCTACTGGC
ACACCTACACGGCGGAATATGACACGCCCGGCGGTGAGCCGGTGGGCGCGGTGATTTCCTCGTATGAGTT
TGACGCCAGTGCGCAGGATATGGCGCTGCTGCGTAACATCTCTAAAGTCTCCGCCGCGGCGCACATGCCG
TTTATCGGTGCCGTCGGCCCGAAATTCTTCCTCAAGGACACCATGGAAGAGGTGGCGGCGATTAAGGACA
TCGGCAACTACTTTGACCGCGCCGAATACATCAAGTGGAAAGCCTTCCGTGACACCGACGATGCCCGCTA
TATCGGCCTGACCCTGCCGCGCGTGCTGGGCCGCCTGCCGTACGGCCCGGACACCGTGCCGGTGCGCAGC
TTTAACTATGTGGAAGAGGTGAAAGGGCCGGACCACGAGAAATACCTGTGGACCAGCGCGTCGTTTGCCT
TCGCGGCCAATATGGTGAAGAGCTTCATTAATAACGGCTGGTGCGTGCAGATCCGCGGCCCGCAGGCGGG
CGGCGCGGTGCAGGACCTGCCGATTCATCTCTATGACCTCGGCACCGGCAATCAGGTGAAAATCCCGTCG
GAAGTGATGATCCCGGAGACGCGTGAATTTGAGTTCGCGAACCTCGGTTTTATCCCGCTCTCCTACTACA
AAAACCGCGACTACGCCTGCTTCTTCTCGGCGAACTCGGCGCAGAAACCGGCGCTGTACGACACGCCGGA
AGCCACCGCCAACAGCCGCATCAACGCGCGCCTGCCGTATATCTTCCTGCTGTCACGCATCGCGCACTAC
CTGAAGCTGATTCAGCGCGAGAACATCGGCACCACCAAAGACCGCCGTCTGCTGGAGCTGGAGCTGAACA
ACTGGGTGCGCGGTCTGGTGACGGAGATGACTGACCCGGGCGACGAGCTGCAGGCGTCACACCCGCTGCG
CGATGCGAAAGTGGTGGTGGAAGATATCGAAGACAACCCGGGCTTTTTCCGCGTCAGGCTGTACGCCGTG
CCGCATTTCCAGGTGGAAGGCATGGACGTCAGCCTGTCGCTGGTGTCGCAGATGCCGAAAGCGAAGTCAT
AA