SecReT6
Protein ID: 449306487
SecReT6 ID734
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_20808
StrainCronobacter sakazakii Sp291
Repliconplasmid pSP291-1 [GenBank: NC_020263] [Browse all T6SS(s) in this replicon]
Location [Strand]55166..55603 [+]
Producthypothetical protein
NoteTssK
UniProt IDM1JQ78
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-25, Aligned region: 18..137
Protein Sequence: 145 a.a.     [Download]
>gi|449306487|ref|YP_007443027.1| hypothetical protein CSSP291_20808 [Cronobacter sakazakii SP291]
MKIYRPLWEDGAFLAPQQFQQQARWDAWVADTVARMTLANPWGVLCAEFDEGALTLARLNATRLVVRFAD
GTLIDTDLADNLPPVCDLSGLEQESVDVLLCLPLLSANGGNLENGQDSARPRRWQSERVPCSSESVRQNE
YASAA
 
Nucleotide Sequence: 438 bp     [Download]
>gi|449306428|ref|NC_020263.1|:55166-55603 Cronobacter sakazakii Sp291 plasmid pSP291-1, complete sequence
ATGAAAATCTATCGCCCGTTATGGGAAGACGGGGCCTTTCTGGCCCCTCAGCAATTTCAGCAACAAGCCC
GCTGGGACGCCTGGGTCGCGGATACGGTTGCCAGAATGACCCTGGCGAACCCGTGGGGAGTGCTTTGCGC
AGAATTTGACGAAGGCGCGTTAACGCTCGCCAGACTCAATGCGACGCGCCTGGTGGTACGCTTTGCCGAC
GGAACGCTGATTGACACCGATCTTGCCGATAATTTACCGCCGGTATGCGATTTATCCGGGCTGGAACAGG
AAAGTGTCGACGTTTTACTTTGCCTGCCGCTCCTCAGTGCGAATGGCGGCAATCTGGAGAATGGACAGGA
CAGCGCCCGTCCGCGCCGCTGGCAGTCTGAACGGGTACCGTGTTCCTCTGAAAGCGTCCGCCAGAATGAG
TATGCGTCAGCCGCTTAG