SecReT6
Protein ID: 449306488
SecReT6 ID734
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_20813
StrainCronobacter sakazakii Sp291
Repliconplasmid pSP291-1 [GenBank: NC_020263] [Browse all T6SS(s) in this replicon]
Location [Strand]55587..55997 [+]
Producthypothetical protein
NoteTssG
UniProt IDM1JLF6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-13, Aligned region: 3..96
Protein Sequence: 136 a.a.     [Download]
>gi|449306488|ref|YP_007443028.1| hypothetical protein CSSP291_20813 [Cronobacter sakazakii SP291]
MRQPLSLKHRPVMGTYATDVNGQVLLMLTTDDAEEARGWLPDGELNRDLNALLHVYLGVHLNVRMQLRVP
RHLLADARLCCKPEYPVQLGRTALLKPLNAAARRNNEMITIPLGRWEQVQENIHRRESDEDGEYRW
 
Nucleotide Sequence: 411 bp     [Download]
>gi|449306428|ref|NC_020263.1|:55587-55997 Cronobacter sakazakii Sp291 plasmid pSP291-1, complete sequence
ATGCGTCAGCCGCTTAGCCTGAAGCATCGTCCCGTCATGGGAACCTACGCCACCGACGTTAATGGTCAGG
TCTTATTGATGCTCACCACTGACGATGCCGAAGAGGCCCGGGGCTGGCTGCCTGACGGAGAGCTTAACCG
CGATCTTAACGCGCTGCTGCACGTCTATCTCGGCGTGCACCTTAATGTGCGAATGCAGCTGCGCGTACCG
CGGCACTTATTAGCGGATGCCCGCCTGTGCTGTAAGCCGGAATATCCCGTGCAACTGGGCCGCACGGCGT
TGCTGAAGCCGCTTAATGCCGCTGCGCGGCGCAATAATGAGATGATTACCATTCCTCTGGGCCGTTGGGA
ACAGGTTCAGGAAAACATTCACCGTAGGGAGAGCGATGAAGATGGCGAATACCGCTGGTAA