SecReT6
Protein ID: 449306489
SecReT6 ID734
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_20818
StrainCronobacter sakazakii Sp291
Repliconplasmid pSP291-1 [GenBank: NC_020263] [Browse all T6SS(s) in this replicon]
Location [Strand]55978..56505 [+]
Producthypothetical protein
NoteTssJ
UniProt IDM1J1V0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.90E-38, Aligned region: 15..166
Protein Sequence: 175 a.a.     [Download]
>gi|449306489|ref|YP_007443029.1| hypothetical protein CSSP291_20818 [Cronobacter sakazakii SP291]
MANTAGKVVAVMLTMAVLAGCGLTQKVTDGAASVTRSLFFRQIKTLHLDIRAREGVNNNESGAALATVVR
IYQLKDRKAFDSTDYPSLFANDSQAIKADLVAEKDIQLRPGESFSLDMPLEETAQYVAVAGMFMAPDDTN
DSWRLVLSRDDLEPDTPRIIEASNNRLTLQPVNDK
 
Nucleotide Sequence: 528 bp     [Download]
>gi|449306428|ref|NC_020263.1|:55978-56505 Cronobacter sakazakii Sp291 plasmid pSP291-1, complete sequence
ATGGCGAATACCGCTGGTAAAGTGGTGGCTGTAATGCTGACGATGGCAGTGCTGGCGGGCTGTGGGTTGA
CGCAAAAAGTCACAGACGGCGCCGCCTCAGTGACCCGCTCGCTGTTCTTCAGGCAGATAAAAACGCTGCA
TCTGGATATCCGGGCAAGGGAAGGCGTCAATAACAACGAGAGCGGGGCAGCGCTGGCGACGGTCGTGCGT
ATTTACCAGCTGAAAGACCGTAAGGCGTTTGACAGCACTGATTACCCCTCGCTATTCGCCAATGACAGCC
AGGCCATTAAAGCGGATCTGGTCGCTGAAAAAGATATCCAGTTGCGGCCAGGAGAATCATTCTCACTGGA
TATGCCTCTGGAGGAGACGGCGCAGTATGTGGCCGTGGCGGGGATGTTTATGGCCCCTGACGACACCAAC
GATAGCTGGCGTCTGGTGCTGTCACGTGACGATCTCGAACCGGATACGCCGAGAATTATTGAGGCCAGCA
ATAATCGCCTCACGCTTCAGCCGGTTAACGACAAATAA