SecReT6
Protein ID: 449309096
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12900
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2711736..2712218 [-]
Producthypothetical protein
NoteTssE
UniProt IDM1JH18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-15, Aligned region: 34..139
Protein Sequence: 160 a.a.     [Download]
>gi|449309096|ref|YP_007441452.1| hypothetical protein CSSP291_12900 [Cronobacter sakazakii SP291]
MERKKQFAPTLLDRLLDEEPKARHEAHDASFINARRYRQLVLRDIDVLLNNTNIEALIDPVRHPAVVNSV
INHGLAPLSGKYATPQSWTMVEQAIRNALLRFEPRIIPSSLVVSPKRQSAPGTTLWFEIAALLYWQPEPV
GFAVSGSYDTETEKTTLTAL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c2712218-2711736 Cronobacter sakazakii Sp291, complete genome
ATGGAGAGAAAAAAACAGTTCGCGCCAACGCTGCTTGACCGGCTGCTGGATGAAGAGCCAAAAGCCCGCC
ACGAGGCGCATGACGCGAGTTTTATTAATGCGCGTCGCTACCGGCAGTTAGTGCTGCGCGATATTGATGT
GTTGCTCAACAACACCAATATTGAAGCGCTCATCGACCCGGTGCGACACCCGGCGGTGGTTAATTCGGTG
ATTAATCACGGCCTCGCGCCGCTCTCCGGGAAATATGCGACGCCGCAAAGCTGGACGATGGTGGAGCAGG
CTATCCGCAACGCATTATTGCGCTTCGAGCCGCGTATTATCCCGTCGTCGCTGGTGGTAAGTCCGAAGCG
GCAGTCCGCGCCGGGTACAACGCTGTGGTTTGAAATAGCGGCGTTGCTTTACTGGCAACCAGAACCCGTC
GGGTTTGCGGTCAGCGGCAGTTATGATACCGAAACGGAAAAAACGACGCTGACGGCGTTATAG