SecReT6
Protein ID: 449309097
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12905
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2712228..2713025 [-]
Producthypothetical protein
NoteTagJ
UniProt IDM1IXT7
KEGG IDcsz:CSSP291_12905
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.20E-44, Aligned region: 145..264
Protein Sequence: 265 a.a.     [Download]
>gi|449309097|ref|YP_007441453.1| hypothetical protein CSSP291_12905 [Cronobacter sakazakii SP291]
MTTEITFKDLLNRAAFDAHFNATTSRLKAQPDNSAARELLFKFYCLEGDWHNALTHLEILKALDAEYTKR
VELYKNLVMSEILRARVLAGDITPAGLTEPLPEWVALLHEANRQFAAGEDEDAERLRQQAFDLAPLTAGE
GEEIAPFSWMADSDGRLGPVCEFICAGGYRWVPFSALRALKIHRPVDLLDLLWLPAQVTLADGQFQGYIP
ARYPLTPQATQETRLGSLTDWQPVSESLCIGLGRKMLITDNADYALPDLRELRFY
 
Nucleotide Sequence: 798 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c2713025-2712228 Cronobacter sakazakii Sp291, complete genome
ATGACGACAGAAATCACGTTTAAGGACTTACTTAATCGCGCGGCGTTTGACGCCCATTTCAACGCAACGA
CGAGCCGCTTAAAAGCGCAGCCTGATAACAGCGCGGCGCGCGAATTGCTGTTTAAATTTTATTGTCTCGA
AGGCGACTGGCATAACGCTCTGACGCACCTGGAGATACTGAAAGCGCTCGATGCGGAATATACAAAGCGG
GTGGAGCTTTATAAAAATCTCGTTATGAGCGAAATATTACGCGCCCGCGTGCTGGCCGGTGACATTACGC
CGGCGGGGCTTACGGAGCCGCTGCCGGAATGGGTCGCGCTGCTTCATGAGGCGAACCGGCAGTTCGCTGC
TGGTGAAGACGAGGATGCCGAACGCCTCCGTCAGCAGGCATTCGACCTGGCACCGCTTACGGCGGGCGAA
GGCGAGGAGATAGCCCCGTTTAGCTGGATGGCCGACAGCGACGGACGACTCGGGCCCGTGTGCGAATTTA
TCTGTGCGGGAGGGTATCGCTGGGTGCCGTTTTCCGCGCTGCGTGCGCTGAAGATCCACCGTCCCGTTGA
CCTGCTGGATCTGCTCTGGCTGCCTGCGCAAGTGACTCTCGCTGACGGGCAGTTTCAGGGCTATATCCCG
GCTCGCTACCCGCTGACGCCGCAAGCGACGCAGGAAACCCGTCTCGGCAGCCTGACCGACTGGCAGCCGG
TCAGCGAGTCGCTCTGTATCGGGCTTGGCAGAAAGATGCTGATTACCGATAACGCGGACTATGCGCTGCC
GGATCTGCGTGAGCTTCGGTTTTATTAA