SecReT6
Protein ID: 449309098
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12910
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2713043..2713831 [-]
Producthypothetical protein
NoteFha
UniProt IDM1JLV6
KEGG IDcsz:CSSP291_12910
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 262 a.a.     [Download]
>gi|449309098|ref|YP_007441454.1| hypothetical protein CSSP291_12910 [Cronobacter sakazakii SP291]
MQIRFIWPANGGAITLNEQHDAAWLDIDSGEFIPAGARERTNVLCFSLRGTQPYMTLAATDYVCFAGHER
LAPGQPYPLRYGLTVQVGRYALQVAMAQETDAAGLPENADEWAVREVDALLSRSVRYVDWQGPQETRADD
DILKRLENEYKRFLAWGAQRRDATSSPASSRLRLKETASDIAQLREQMKEKTLTECILGSSALIAQALEA
LSGLEADPELFSAPRYDILKMLSPDAQHIKAPTRLPALTVREFHQPDLDSLL
 
Nucleotide Sequence: 789 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c2713831-2713043 Cronobacter sakazakii Sp291, complete genome
ATGCAGATACGTTTCATCTGGCCCGCCAATGGCGGGGCAATCACCCTGAATGAGCAGCATGACGCGGCCT
GGCTTGATATCGACAGCGGCGAGTTTATCCCTGCCGGGGCCAGAGAGAGAACTAACGTGCTGTGCTTTTC
ACTGCGCGGAACGCAGCCTTACATGACGCTCGCGGCAACAGATTATGTCTGTTTCGCCGGACATGAACGC
CTTGCGCCCGGGCAGCCTTACCCTCTGCGCTATGGCCTGACGGTGCAGGTCGGGCGATATGCGCTGCAGG
TGGCGATGGCGCAGGAAACGGATGCCGCAGGATTGCCGGAAAACGCCGATGAATGGGCGGTGCGCGAGGT
CGACGCGCTTCTCTCCCGCAGCGTGCGCTATGTCGACTGGCAAGGCCCGCAGGAGACACGCGCTGACGAC
GACATCCTGAAAAGACTGGAAAACGAATATAAACGCTTTCTGGCCTGGGGCGCGCAGCGGCGCGATGCCA
CGTCTTCGCCTGCCTCTTCGCGACTGCGCCTGAAAGAGACCGCGTCAGACATTGCGCAGCTTCGCGAACA
GATGAAAGAGAAAACGCTCACCGAATGCATTCTGGGATCGTCGGCGCTGATAGCACAGGCGCTGGAGGCG
TTATCAGGCCTTGAGGCGGATCCCGAACTGTTTAGCGCGCCGCGCTATGACATCCTGAAAATGCTATCGC
CGGATGCGCAGCACATAAAAGCCCCCACACGGCTTCCCGCTCTGACGGTGCGGGAATTCCATCAACCCGA
TCTGGATAGTTTGCTCTGA