SecReT6
Protein ID: 449309099
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12915
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2713837..2714097 [-]
Producthypothetical protein
NotePAAR
UniProt IDM1JWY9
KEGG IDcsz:CSSP291_12915
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 9.00E-20, Aligned region: 6..79
DUF4150 [PF13665], Evalue: 9.20E-05, Aligned region: 13..40
DUF4150 [PF13665], Evalue: 9.20E-05, Aligned region: 39..71
Protein Sequence: 86 a.a.     [Download]
>gi|449309099|ref|YP_007441455.1| hypothetical protein CSSP291_12915 [Cronobacter sakazakii SP291]
MQNAARAGDAISHGGAISNGSGNVSINGAPAAMQGASSASCSIHGASAVSSGSGSVFINNNPAARTGDAT
GCGAAISSGSGDVFIG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c2714097-2713837 Cronobacter sakazakii Sp291, complete genome
ATGCAAAATGCAGCACGGGCAGGCGATGCCATCAGCCACGGCGGTGCCATTTCCAACGGTTCCGGGAATG
TGTCCATCAATGGCGCGCCAGCGGCCATGCAGGGAGCCAGCAGCGCGAGCTGTTCCATTCACGGCGCGTC
AGCCGTTTCATCAGGCTCAGGATCGGTCTTTATCAACAATAATCCCGCCGCCAGGACAGGCGACGCCACG
GGCTGTGGCGCGGCCATCTCCAGCGGCTCCGGCGATGTATTCATCGGCTAA