SecReT6
Protein ID: 449309100
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12920
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2714153..2715904 [-]
Producthypothetical protein
NoteTssI
UniProt IDM1JL65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 1.50E-26, Aligned region: 138..231
Phage_GPD [PF05954], Evalue: 1.30E-11, Aligned region: 23..101
Protein Sequence: 583 a.a.     [Download]
>gi|449309100|ref|YP_007441456.1| hypothetical protein CSSP291_12920 [Cronobacter sakazakii SP291]
MCERKKVEALAAGKIFLKPRNTSFNQMEMYHWPGDYAQPNIGEQLARVRMEERGALGSRATGDGELRGVV
CGCNFVLSGYPVAKANREYLVISSRLDIEDNAQVSGFEDYRWHCHFVVQPTNKIYRHPLHTPRPRTRGPQ
TAIVVGPPGEEVWTDKYGRVKVRFVWDRYGKNRESDSCWLRVSQSWAGNNFGGIYIPRIGHEVIVDFING
DPDRPLIIGSLYNNITMPPWDLPGNATQSGMISRTIGGGRTNFNGIRFEDKPGLEQYWEQAERNMERLTK
KDETQTIGENSKLSVGLNRDVFVGANYVKKILGGCRKLIGLGAFMQVGLTREVMVGGAQAHHIGGANSLN
VGGADLTNVGGYSGTSVGGAWQVAAGGAATVAAGGAMSLSSGGELIISADTIKIIGSSKVVIQGGQVQLN
PGDGGCSCGNSSGGGMGALASLAGLMPLMGIMVLPLPLPPLPIPIPIPVPIPTHCPTDTPTDTPTDTPTD
TPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTP
TDTPTETPTETPTETQTAPPKFW
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c2715904-2714153 Cronobacter sakazakii Sp291, complete genome
TTGTGTGAGCGTAAAAAAGTAGAAGCGCTGGCGGCAGGTAAAATATTCCTGAAGCCGCGTAACACCAGCT
TTAACCAGATGGAGATGTATCACTGGCCTGGCGATTACGCACAGCCAAATATTGGCGAACAGCTGGCGCG
GGTGCGCATGGAAGAGCGTGGCGCTCTGGGCTCACGCGCGACAGGCGACGGCGAGCTTCGGGGCGTCGTC
TGCGGCTGTAATTTTGTATTAAGCGGCTATCCCGTTGCGAAAGCCAACCGGGAATATCTGGTTATTTCCA
GCAGGCTTGATATCGAGGACAACGCTCAGGTAAGCGGTTTTGAAGATTATCGTTGGCACTGCCATTTTGT
CGTTCAGCCGACCAATAAAATTTATCGTCACCCCCTGCACACGCCACGGCCACGCACGCGCGGGCCGCAG
ACGGCGATTGTCGTCGGGCCGCCTGGCGAAGAGGTCTGGACGGACAAATATGGCCGCGTGAAAGTACGGT
TTGTCTGGGATCGTTACGGTAAAAACCGTGAATCAGATTCCTGTTGGCTGCGCGTCAGCCAGTCATGGGC
AGGCAACAACTTTGGCGGCATTTATATTCCCCGCATCGGGCATGAAGTGATTGTCGATTTCATCAACGGT
GACCCGGACCGGCCGCTGATTATTGGCAGCCTGTATAACAACATTACGATGCCGCCGTGGGATCTGCCGG
GTAATGCCACGCAAAGCGGCATGATAAGCCGCACTATCGGCGGCGGGCGCACCAATTTCAACGGGATCCG
CTTTGAGGATAAACCCGGTCTTGAGCAGTACTGGGAGCAGGCCGAGCGCAATATGGAACGCCTGACGAAA
AAAGATGAAACCCAGACGATTGGCGAAAATTCAAAACTTTCTGTGGGCCTGAACCGGGATGTCTTTGTCG
GTGCGAATTACGTTAAAAAAATCCTCGGTGGCTGCCGCAAACTGATTGGGCTTGGCGCTTTTATGCAGGT
CGGGCTGACGCGCGAGGTGATGGTCGGCGGCGCGCAGGCGCACCATATTGGCGGCGCGAATTCCCTTAAC
GTTGGGGGAGCGGATCTCACAAACGTTGGCGGCTACAGCGGCACCTCCGTGGGCGGCGCGTGGCAGGTGG
CCGCGGGCGGCGCGGCGACAGTGGCAGCAGGCGGTGCCATGTCGCTGAGCTCCGGCGGGGAGCTGATTAT
TTCAGCCGATACGATCAAAATTATTGGCAGCAGTAAGGTGGTGATACAGGGGGGCCAGGTGCAGCTCAAC
CCTGGCGATGGCGGGTGTTCCTGCGGTAACAGCAGCGGTGGCGGTATGGGCGCACTGGCAAGCCTTGCGG
GGCTGATGCCGCTGATGGGGATTATGGTTTTACCGCTGCCTCTGCCGCCACTGCCTATTCCTATTCCCAT
TCCTGTTCCCATCCCGACGCATTGTCCGACGGATACGCCGACCGATACGCCGACCGATACGCCAACGGAT
ACGCCAACGGATACGCCAACGGATACGCCAACCGATACGCCAACCGATACGCCAACCGATACGCCAACCG
ATACACCAACCGATACGCCAACGGATACGCCGACGGATACGCCGACGGATACGCCGACCGATACGCCGAC
GGATACGCCGACCGATACGCCGACGGATACGCCGACCGATACGCCAACGGATACGCCGACCGATACGCCA
ACCGATACGCCGACCGAAACGCCGACCGAAACGCCAACGGAGACGCAAACGGCGCCGCCCAAATTCTGGT
AA