SecReT6
Protein ID: 449309101
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12925
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2715956..2716945 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDM1JH21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-99, Aligned region: 2..328
Protein Sequence: 329 a.a.     [Download]
>gi|449309101|ref|YP_007441457.1| type VI secretion protein [Cronobacter sakazakii SP291]
MLDNAPQDLVAHITAARFLLFCTPVINLFPKQMDRIEINRALNEFHVVADRSRPLDYEIFSISKVAGQQA
ESSNEVTFSPLFQTRHYHHGNAGRYFSHTRRPRTLDKNVRHYETRTSYRGTEVFISLVDQHEAPFSDDLR
YLSVDALVTNRDLPVLLSRSGHFDLTMTDAAPVESARFVCAPSFPHSPFAEGESAWRLIRQLSFNYQPLA
DMDHSTGGEALRKMLRLFISHSDHEASTQIDALVGCKSEPIVRRLPDDGLLIYGRGVRCTLTVDEAGFSG
ISPYLFGLIMENYIARHAAINVFTETELVSMQRGRISRWKARPGRRGVL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|449306535|ref|NC_020260.1|:2715956-2716945 Cronobacter sakazakii Sp291, complete genome
TTGCTTGATAACGCGCCTCAGGATCTGGTGGCCCATATCACGGCTGCGCGCTTTCTGCTTTTTTGTACAC
CGGTGATAAATCTGTTTCCCAAACAGATGGACAGAATCGAAATTAACCGGGCATTGAATGAGTTTCATGT
TGTTGCCGATCGCAGTCGCCCACTGGATTACGAAATTTTTTCGATAAGTAAAGTGGCAGGACAGCAGGCT
GAAAGCAGCAACGAAGTCACGTTCAGTCCTCTTTTCCAGACGCGTCATTACCATCATGGGAATGCCGGAC
GTTATTTTTCTCATACCCGACGCCCCAGAACGCTGGACAAAAACGTTCGTCATTATGAAACACGCACCTC
GTATCGGGGCACCGAAGTGTTTATCTCGTTGGTTGACCAGCATGAGGCGCCTTTCAGCGACGATCTTCGT
TATTTATCGGTCGATGCGCTGGTCACTAATCGCGATCTGCCCGTTTTGCTTTCTCGTTCTGGCCATTTTG
ATCTCACCATGACCGACGCCGCACCGGTTGAAAGCGCACGATTTGTCTGCGCGCCCTCTTTTCCACACTC
TCCTTTTGCAGAAGGCGAATCCGCCTGGCGACTGATACGACAGCTCAGTTTCAATTATCAGCCGCTGGCA
GACATGGATCACAGCACGGGTGGAGAAGCGCTACGCAAGATGCTGCGGTTGTTCATCAGCCATTCTGATC
ATGAGGCCAGTACCCAGATAGATGCCCTGGTGGGATGTAAAAGCGAGCCCATTGTCCGCCGCTTACCCGA
TGATGGCCTGCTTATTTATGGCAGAGGCGTGCGCTGTACCCTGACGGTAGACGAGGCAGGTTTCTCAGGC
ATTAGTCCGTATCTCTTCGGTCTCATTATGGAAAATTACATCGCCCGACATGCTGCGATTAATGTGTTCA
CCGAAACAGAATTAGTCTCCATGCAACGTGGACGCATCAGTCGCTGGAAAGCGCGCCCGGGAAGGCGAGG
CGTTTTGTAA