SecReT6
Protein ID: 449309102
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12930
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2716945..2717973 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDM1IXU2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-95, Aligned region: 22..321
Protein Sequence: 342 a.a.     [Download]
>gi|449309102|ref|YP_007441458.1| type VI secretion protein [Cronobacter sakazakii SP291]
MFPETPEKTALPACLEAWYQHEAPWQSGFISVLRAIAARYSHRPPVGRAALPSEEAFRIGQRAYMAFAPR
EIACMDWRNGKVNLQVFGTGVWGAQGAMPLHFTELVYSRMENHDHALADFVDLFHHRALSLFYRAWFISQ
DSATLDRTDDEKFAFYVGSLAGLDLQEITASSLPSHARLRSTAHLVREARNPEGLLGAIQDYFQVPVNIK
EFVGQWIVLERCDQTQLGNNDAAMLLGKGAILGETVLDRQHKFQLIIGPLSLEQYLRFSPWGQDLPILKE
WVRNFVGFEYAWEVQLLLNAQAVPHASLDGTHQLGYASWLPREESTKPLYGMCFEPELNQHG
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|449306535|ref|NC_020260.1|:2716945-2717973 Cronobacter sakazakii Sp291, complete genome
ATGTTTCCCGAAACCCCAGAGAAAACGGCGCTACCCGCTTGCCTGGAAGCGTGGTATCAACATGAAGCCC
CCTGGCAATCAGGGTTTATCAGCGTATTACGTGCTATCGCGGCACGATATTCTCACCGGCCGCCGGTCGG
GCGCGCCGCCCTGCCTTCAGAGGAAGCGTTCAGAATTGGCCAGCGCGCGTATATGGCATTTGCGCCACGT
GAAATCGCCTGCATGGACTGGCGCAACGGCAAGGTGAATCTGCAGGTTTTTGGAACCGGCGTATGGGGCG
CGCAAGGAGCAATGCCACTCCATTTTACCGAACTCGTCTACAGCCGAATGGAGAATCACGATCACGCGCT
GGCGGATTTTGTCGATCTCTTCCATCACCGCGCGCTTTCTCTTTTTTATCGTGCCTGGTTTATTTCACAG
GATTCCGCGACGCTTGACAGAACCGATGACGAAAAATTCGCCTTTTATGTAGGGAGTCTGGCCGGGCTGG
ATCTTCAGGAAATCACCGCCTCCTCGCTGCCCTCTCACGCAAGGCTGAGATCAACTGCACATCTTGTGCG
GGAGGCGCGAAACCCGGAGGGATTGCTTGGCGCTATCCAGGACTATTTCCAGGTACCCGTCAATATCAAG
GAGTTTGTCGGTCAGTGGATCGTTCTGGAGCGTTGTGATCAAACGCAATTAGGCAATAACGACGCCGCGA
TGTTACTCGGTAAAGGCGCGATACTCGGTGAAACCGTACTGGATCGCCAGCATAAATTTCAGCTCATCAT
CGGGCCGCTCAGTCTTGAGCAATACCTGCGTTTTAGCCCGTGGGGTCAGGATCTTCCCATCCTGAAAGAA
TGGGTGCGCAATTTTGTCGGCTTTGAATACGCATGGGAAGTACAACTGCTTCTTAACGCGCAGGCGGTGC
CGCATGCCTCGCTGGATGGCACACACCAACTCGGCTACGCCAGCTGGCTTCCCAGAGAAGAGTCTACGAA
ACCGCTCTATGGCATGTGTTTTGAGCCTGAACTTAACCAACATGGCTGA