SecReT6
Protein ID: 449309103
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12935
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2718028..2719074 [+]
ProductImpA family protein
NoteTssA
UniProt IDM1JLW0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-19, Aligned region: 61..120
Protein Sequence: 348 a.a.     [Download]
>gi|449309103|ref|YP_007441459.1| ImpA family protein [Cronobacter sakazakii SP291]
MDIDTLQVSEYYQPLMMPLPGAFPCGVNLEYDSDFILLLSRLQPRLDAEYGQFIEAAEPVNWAEIERDCL
ALFNRSKDIRLLIILMRCRLRQTGLTALEEGLIALSFFLTRWPEDIHPQLYDEGEFDPLMRINALNELED
IHGIIGDLRNQLLPKAAGTQITLKIFEKSHALPRDSDALPEIMLSALRLEWKTRNDPVIRSLQVAKAWLD
KIKNIIPQKTNIDMPDFPHMSQLLSLFLSEDEQSAVYCETPVASPQPGASGEESIVPVLMPEEVSAQVTM
IAQPHTINSRTEALSRLKEIRAWFIHAEPSSPVIPLLAFTERTIGMHFNELLKFIPAELISRLDAEKD
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|449306535|ref|NC_020260.1|:2718028-2719074 Cronobacter sakazakii Sp291, complete genome
ATGGACATAGATACTCTGCAGGTATCGGAATATTATCAACCACTCATGATGCCTCTCCCAGGTGCATTTC
CGTGCGGTGTAAACCTCGAATATGACTCCGATTTCATTTTACTGCTGTCACGATTACAGCCGAGGCTTGA
TGCGGAATATGGCCAGTTCATCGAGGCCGCAGAACCCGTAAACTGGGCGGAAATTGAACGTGACTGTTTA
GCCCTGTTCAACCGCAGTAAAGATATCAGATTGCTGATTATTCTTATGCGGTGCCGCTTGCGACAAACAG
GACTGACGGCGCTTGAGGAAGGGCTCATTGCGCTATCTTTTTTTCTCACGCGCTGGCCTGAAGATATTCA
TCCACAGCTTTATGACGAAGGGGAGTTCGATCCCCTGATGCGTATTAACGCGCTAAATGAGCTGGAAGAT
ATTCATGGCATCATTGGCGATTTGCGTAATCAATTGTTGCCCAAAGCCGCCGGTACGCAGATCACACTTA
AAATATTCGAAAAATCGCATGCTCTCCCGCGCGACAGCGATGCATTGCCTGAAATAATGCTTTCCGCCTT
ACGTCTCGAATGGAAAACGCGGAATGATCCTGTAATCCGCTCCTTACAAGTGGCAAAGGCATGGCTCGAT
AAGATAAAAAATATAATCCCGCAGAAAACCAATATCGATATGCCTGATTTTCCTCATATGAGCCAGCTTT
TGAGCCTCTTTCTCTCAGAGGATGAACAGTCAGCGGTCTATTGCGAAACTCCGGTTGCTTCCCCTCAACC
GGGCGCGTCAGGAGAGGAGTCAATAGTGCCTGTGCTGATGCCAGAAGAGGTATCTGCGCAAGTAACAATG
ATAGCGCAACCGCACACTATTAATAGTCGAACGGAGGCGCTTTCCCGGCTTAAAGAAATCCGCGCCTGGT
TTATTCATGCCGAGCCAAGTAGCCCCGTTATACCGCTACTGGCTTTTACCGAGCGGACCATCGGAATGCA
CTTCAATGAGTTATTAAAGTTTATCCCGGCGGAATTAATTTCCCGACTGGACGCAGAAAAGGATTAA