SecReT6
Protein ID: 449309108
SecReT6 ID732
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_12960
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]2722653..2723639 [+]
ProductOmpA/MotB family protein 2
NoteTagL
UniProt IDM1JLW3, M1JLW3
KEGG IDcsz:CSSP291_12960
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.40E-14, Aligned region: 212..308
Protein Sequence: 328 a.a.     [Download]
>gi|449309108|ref|YP_007441464.1| OmpA/MotB family protein 2 [Cronobacter sakazakii SP291]
MGTSNNIETRQRSLMGKPLLNWLQTTPLREALMPLTTHPTLCLSGIVVADDGQGFTRHGAWARFLENQYG
VLPPLSSALLLPPLPPALKAVSLSQDTVKNQRTAGTLMSVTAVFILLAASLLTAFHHAREQTQLTTSLIA
HTEALEPWRIRARRAALAALEAQQQRLLACAEKPRLIDWGLSPCSRLQQEAQAVIGRYRNLPYYSSQAPV
SLFSSGSARLRPHGPAALQPLFTLVNQHPENRFLIIGHSDNTGSPEVNQQLSVSRAIAVREWLVKITKRP
AIQFDIYGLGASEPVAGNDNETGRELNRRVEAIALPADSMEIRKFKNE
 
Nucleotide Sequence: 987 bp     [Download]
>gi|449306535|ref|NC_020260.1|:2722653-2723639 Cronobacter sakazakii Sp291, complete genome
ATGGGCACGTCGAACAACATCGAAACGCGTCAGCGAAGCCTCATGGGCAAACCGTTGCTGAACTGGCTGC
AGACCACGCCGTTACGTGAAGCGCTGATGCCACTCACGACACATCCCACGCTATGTCTGAGTGGCATTGT
GGTGGCCGATGACGGTCAGGGTTTTACGCGCCACGGGGCGTGGGCGCGCTTTCTGGAAAATCAGTATGGC
GTGCTTCCGCCGCTCTCTTCCGCGCTGCTGTTGCCGCCGCTGCCGCCAGCATTAAAAGCTGTCTCGCTCT
CACAAGACACCGTGAAAAACCAGCGCACCGCAGGAACATTAATGAGCGTTACCGCCGTTTTCATCCTGCT
TGCCGCCTCGCTGCTCACTGCATTTCATCACGCGCGTGAACAGACTCAGCTGACAACGTCCCTGATTGCG
CATACCGAAGCACTCGAACCGTGGCGAATACGCGCCCGGCGCGCCGCACTGGCGGCACTTGAAGCACAGC
AACAGCGTCTTTTAGCGTGCGCGGAAAAACCGCGGCTCATCGACTGGGGTTTATCGCCGTGCTCGCGTCT
GCAACAGGAGGCCCAGGCCGTCATCGGGCGCTACAGGAATTTACCTTATTACAGCTCGCAGGCACCGGTG
TCACTCTTTTCATCGGGCAGCGCCCGTCTGCGGCCGCACGGCCCGGCCGCACTGCAGCCTCTGTTCACGC
TGGTGAATCAACACCCGGAAAACCGTTTTCTGATTATTGGCCACTCGGATAACACCGGCAGCCCTGAGGT
TAACCAGCAGCTTTCCGTAAGCCGGGCGATCGCGGTGCGGGAATGGCTTGTGAAAATTACAAAGAGGCCT
GCGATCCAATTTGATATTTACGGTCTCGGCGCCAGCGAGCCTGTCGCCGGTAATGACAATGAAACGGGCA
GAGAGCTTAACCGGCGGGTTGAAGCCATCGCGCTGCCCGCCGACTCAATGGAAATAAGGAAATTCAAAAA
TGAGTAA