SecReT6
Protein ID: 449310121
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18125
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3875471..3877609 [-]
Producthypothetical protein
NoteTssI
UniProt IDM1JK30
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-74, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 8.10E-74, Aligned region: 478..532
Phage_GPD [PF05954], Evalue: 8.10E-74, Aligned region: 553..597
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 1.70E-16, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.70E-16, Aligned region: 517..538
Gp5_C [PF06715], Evalue: 1.70E-16, Aligned region: 541..562
Gp5_C [PF06715], Evalue: 1.70E-16, Aligned region: 565..587
Gp5_C [PF06715], Evalue: 1.70E-16, Aligned region: 581..602
Protein Sequence: 712 a.a.     [Download]
>gi|449310121|ref|YP_007442477.1| hypothetical protein CSSP291_18125 [Cronobacter sakazakii SP291]
MLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYLNGK
VTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSYRVW
EYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLVLTDAPGQYEPFPGYETIPYHVTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQ
VEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTIAHYRFEENRYASGPDSNTLHEIRFEVIPADV
PYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRFEDKAG
EEQVWLHAEKNMDTEIENDETHSVGSNRTKTIGANETTTVKKNRTETVVENETITVHQNRTETVDGNETI
TIHSNRTETVDQNEDVRIGQNQSVTVNGAQTLRVDKTKTETIALASMLNVGLAQNTNIGAAYVLNVGAGW
MTNVGAMQMHNVALKYSVNSGKDLSLSAGTTADFSAEDKITLVCGESMIVLEQNGTITLSANKIKMVGEK
VIDIDGTEININ
 
Nucleotide Sequence: 2139 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3877609-3875471 Cronobacter sakazakii Sp291, complete genome
ATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGGCGCGAGG
CGCTGTCGGAGCCGTTCATGTTCACCCTGACGCTGCTCGGCACCGACGCGCGGGCCGACCGCAGCGCGCT
GCTGGGGCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTTAACGGCAAG
GTGACCCGCGTGGCGGTGAGCGCGGTGGAGCTCTCCGGCACGCGTTATGCCGCCTATGAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGCAGCGCGACCGCAACCTGCGCATCTTCCAGGGGCAGACGGTGCCGCAGAT
AGTGAAAACGCTGCTGGGTGAAAGCCGGGTGAACATGGAAGAGCGCCTTTCCGGCAGCTACCGCGTCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGTCTGGACTTTATCAGCCGCCTGCTGGAGCTGGAGGGCATCG
CCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTGGTGCTGACGGACGCGCCGGGCCAGTACGAGCC
GTTCCCGGGCTACGAGACCATTCCGTACCATGTGACCCCTTCAGGCGGCAGCACAGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGCATTGATGTTTACGA
CTGGCCGGGGCGTTTTGTGGAGCACGGTCACGGCGAGTTCTACGCCCGCATCCGCCAGGAGCGCTGGCAG
GTGGAGCACCGCCAGACGCAGGGCACCGCGACGGCGCTCGGCATCGCGCCCGGCCACACCTTTGTGCTGC
GCAACGCCCCGTTCTTCGGCGATAACGGCGAGTACCTCACCACCATCGCCCACTACCGCTTCGAGGAGAA
CCGCTACGCCAGCGGCCCGGACAGCAACACACTGCACGAAATCCGCTTTGAGGTGATACCGGCGGACGTG
CCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGCGAGAGCATCTGGACGGATAAATACGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGCCTCGG
CAAGGGCGACGACACCAGCTCCAGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTTCGGCGGG
GTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TAACGGGGCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCTGCCGCGGCGACACAGATGGG
CTTTTTAAGCCGCTCGAAGGACGGCTCGCCGGACAACGCCAACGCCCTGCGCTTTGAGGACAAGGCGGGC
GAGGAGCAGGTGTGGCTGCATGCTGAAAAGAACATGGATACCGAAATCGAGAACGATGAAACGCATTCGG
TAGGCAGCAACCGCACCAAAACCATTGGCGCGAATGAAACCACGACGGTGAAGAAAAACCGCACGGAAAC
GGTCGTGGAAAATGAAACGATCACGGTGCATCAGAACCGCACAGAGACGGTGGATGGCAATGAAACCATC
ACTATTCATTCCAACCGTACCGAGACGGTCGATCAGAACGAAGACGTGCGTATCGGGCAAAACCAGAGCG
TGACCGTTAACGGTGCGCAGACGCTGCGCGTCGATAAGACCAAAACCGAAACCATCGCGCTCGCCTCCAT
GCTGAACGTCGGTCTCGCGCAAAACACCAATATTGGCGCGGCGTATGTGCTGAACGTCGGCGCAGGCTGG
ATGACCAACGTCGGCGCGATGCAGATGCATAACGTGGCGCTCAAATATTCGGTGAACTCCGGTAAAGATC
TCAGCCTGTCAGCGGGCACCACGGCGGATTTCAGCGCGGAAGACAAAATCACGCTGGTCTGCGGGGAATC
GATGATTGTGCTGGAACAGAACGGCACCATTACGCTTAGCGCCAACAAAATAAAGATGGTCGGCGAAAAG
GTCATCGACATCGACGGTACGGAAATCAATATCAACTGA