SecReT6
Protein ID: 449310126
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18150
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3884365..3885408 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDM1JK35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-108, Aligned region: 27..331
Protein Sequence: 347 a.a.     [Download]
>gi|449310126|ref|YP_007442482.1| type VI secretion system protein ImpH [Cronobacter sakazakii SP291]
MSETQPQPAPVKSASRLPENYWQQMMAAPWRYDLFQMLRRLDAQGGERYRLGRAPLPRFEPLRIGQQPSM
AFAPSTLAAVKPRDNTPLYDVSILSFGLFGPNGPLPMHLTEYARERLYHHQDDSLSAFADLFHHRLTLLF
YRAWADAQPTASLDRTDGPRIEKYLASLIGMGQPGQMEKGSLSHHARYSLVGHLTRNGRDAEGLEKILRH
YFHVPVTIVQNIPQWMPLTEREKARLGAGRRMPRLGEAAFLGVAVRDVQHKFRIELGPLDEETYQRFLPG
EPWVEELRDWVRQYMGIEYEWEVRVILRADAVKGVTPGGTGRLGYSAWLGKQPTPQPRGDLVFRAES
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3885408-3884365 Cronobacter sakazakii Sp291, complete genome
ATGAGTGAGACGCAGCCACAACCCGCGCCGGTAAAAAGCGCCTCCCGGCTGCCGGAGAATTACTGGCAAC
AGATGATGGCCGCGCCGTGGCGCTACGATCTGTTCCAGATGCTGCGCCGTCTCGACGCGCAGGGCGGCGA
ACGCTACCGTTTAGGCCGCGCGCCGCTGCCGCGCTTTGAGCCGCTGCGCATCGGCCAGCAGCCGTCGATG
GCCTTCGCGCCGTCAACGCTCGCCGCGGTGAAACCGCGCGACAACACGCCGCTGTACGATGTGTCGATTT
TAAGCTTCGGCCTGTTTGGCCCGAACGGCCCGCTGCCGATGCACCTGACCGAATATGCGCGCGAGCGTTT
GTATCATCATCAGGACGACAGCCTGAGCGCGTTCGCGGATCTGTTTCATCACCGCCTGACGCTGCTGTTC
TACCGCGCCTGGGCCGACGCCCAGCCGACCGCGTCGCTCGACCGCACTGACGGGCCGCGCATTGAAAAAT
ATCTCGCCTCGCTTATCGGCATGGGCCAGCCGGGGCAGATGGAAAAGGGCAGCCTCAGCCACCACGCGCG
CTATTCGCTGGTCGGCCATTTGACGCGCAACGGGCGCGACGCCGAAGGGCTTGAAAAAATTCTGCGCCAC
TATTTCCACGTGCCGGTGACGATTGTGCAGAACATCCCGCAGTGGATGCCGTTAACCGAGCGTGAGAAAG
CGCGTCTCGGCGCGGGCCGCCGGATGCCGCGTCTCGGCGAGGCAGCGTTCCTCGGCGTGGCGGTGCGCGA
CGTGCAGCATAAATTTCGCATTGAGCTCGGCCCGCTGGATGAAGAGACCTATCAGCGTTTTCTGCCCGGC
GAGCCGTGGGTCGAGGAGCTGCGCGACTGGGTGCGTCAGTATATGGGCATCGAGTATGAGTGGGAGGTGC
GCGTTATCCTGCGCGCCGACGCGGTAAAAGGCGTCACGCCTGGCGGCACGGGCCGCCTCGGCTACAGCGC
CTGGCTTGGCAAGCAGCCCACCCCGCAACCGCGCGGCGATCTGGTTTTTCGCGCGGAAAGTTAA