SecReT6
Protein ID: 449310127
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18155
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3885405..3887276 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDM1J0K3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-208, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|449310127|ref|YP_007442483.1| type VI secretion system protein ImpG [Cronobacter sakazakii SP291]
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQLLKKNGVTCSYATAHDVRLLP
LHISQVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGPVLLNHLDFDRLDFFLSGPDIQALQLLELLM
EHRVGIFCQTVGPKPSRVVLADDALRQEGFEADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGIGK
LLAQSGQANAFDIIILLDKTDTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPL
DYEIFSVSKIYASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSLRREQRALSEHALRYGTRTGYVGSEAFV
SLVDASHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHCVLEPVHRRVPEPGPIVFARG
VGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEFTLKSQQRGEVGYWGPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3887276-3885405 Cronobacter sakazakii Sp291, complete genome
ATGGACAGTAAACTGCTCGAATACTACAACCGAGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAGTTCG
CCGAACGCTACCCGAAAGTGGCGGGCAGGCTCGGTATGCGCGGGATTGAAGTCGCTGACCCGTACATCGA
GCGCCTGATGGAAGGCTTCGCCTTTCTCACCTCCCGCGTACAGCTCAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGCTCGCGCCGAATTATCTGGCGCCCACGCCGTCAATGGCGATAGCCG
AACTGCACCCGGACAGCGCCAAAGGGGATCTGAGCAACGGGTTTGTGGTGCCGCGCGGCACGATGATGGA
CAGCCAGCTTCTGAAAAAGAACGGCGTCACCTGTAGCTACGCCACCGCCCATGACGTGCGCCTGCTGCCG
CTGCATATCAGCCAGGTGGAGTTAGGCGGCGTGCCGGCCGATGCGCCGTTAAGCCAGCTCGGTTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCGTGCGCATCGCGTGCGACGGCCCGGTGCTGCTCAACCATCTCGA
TTTCGACCGCCTCGATTTCTTCCTGAGCGGGCCGGATATCCAGGCGCTGCAACTGCTGGAATTGCTGATG
GAGCACCGCGTCGGCATCTTCTGCCAGACTGTCGGCCCGAAACCATCGCGCGTGGTGCTCGCCGACGACG
CGCTGCGTCAGGAAGGCTTTGAGGCTGACCAGGCGCTGCTGCCGGACGATCTGCGCAATTTCGACGGCTA
CCGCCTGTTGCAGGAATATTTCGCGTTCCCGGCGCGCTTCCAGTTTTTAAGCCTGCGCGGCATCGGCAAG
CTGCTGGCGCAGAGCGGGCAGGCGAACGCGTTCGATATCATTATTCTGCTGGATAAAACCGACACGCCGC
TGGAGCGCGTGGTGGATAAGAGCCACCTCGCGATGCACTGCACGCCGGTCATCAATTTGTTCCCGAAAAT
CGCCGAGCGCCAGAAGCTCACCGAGGGCTTAAGTGAATATCACCTGGTGGTGGATAACATTCGCCCGCTC
GATTACGAGATATTCTCGGTCAGTAAAATTTACGCCAGCGAAGATGGCCAGCGCGACGACCAGATCTTCC
GCCCGTTCTGGAGCACCTGGAGCCGCGACGGCGGCAACTACGGCGCGTATTTCTCGCTGCGCCGTGAACA
GCGCGCGCTCTCGGAACACGCGCTGCGCTACGGCACGCGTACCGGCTATGTCGGCTCCGAGGCGTTTGTA
TCGCTGGTGGACGCAAGCCACGCGCCGTGGCGCGACGAACTGCGCTATATCACCGCTGAAGTGATGTGCA
CCAGCCGCGATCTGCCGCTGATGCTGGCGCAGGATATGGGCCAGTTCGTGCTGCCGGATTCCATGCCGGT
GCGTGCGCTCACCATGCGTAAAGGGCCGACGCCGCCGCGCCCGGCGCTGGCCGAAGGGTTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAAATGAACTACTTAAGCCTGATGGACGCCGAAGATGGCGAGGGCGCGGCGG
CGCTGCGCCAGTTGCTCGGCCTCTATGCGCGCCTGGCGGAAGCGCCGGTGGCGCGCCAGATTGACGGCAT
TCGCCACTGCGTGCTGGAGCCGGTGCACCGCCGCGTGCCGGAGCCGGGCCCGATTGTGTTCGCCCGCGGC
GTCGGGATTTCGATGACCGTCGATGAGCAGGCGTTTTCCGGCTCCAGCCCGTGGCTGCTTGGCAGCGTGC
TGGAGCGCGTCTTCGCACGCCTGGTCTCTATGAACAGCTTCACCGAGTTCACGCTCAAGAGCCAGCAGCG
CGGCGAAGTGGGCTACTGGGGGCCGCGAATGGGTAAAAGGGCGCTGATATGA