SecReT6
Protein ID: 449310128
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18160
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3887279..3887851 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDM1JPV3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 58..166
Protein Sequence: 190 a.a.     [Download]
>gi|449310128|ref|YP_007442484.1| type VI secretion system protein ImpF [Cronobacter sakazakii SP291]
MNKPYQDDDSGDLLRHGYRSRRNATTVSARDKMQPSLLDRLTDNAPDKRQEPANSNLVSHSALRRQVLRD
LQWLFNTINNEAQQDLSRVDHVRRSVFNFGVAPLAGKRMSEIEWGDIQQRLTEAILHFEPRILPQGLQVR
CVCDTKSLDLHNVLSIEIKGRLWCVPWPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3887851-3887279 Cronobacter sakazakii Sp291, complete genome
ATGAATAAACCGTATCAGGATGACGACAGCGGCGATCTGCTGCGCCACGGCTATCGTTCGCGCCGCAACG
CCACGACGGTCAGCGCGCGCGACAAAATGCAGCCGTCGCTGCTGGACCGTCTGACCGATAACGCGCCGGA
CAAACGTCAGGAGCCGGCGAACAGCAATCTCGTCTCGCACAGCGCGCTGCGCCGCCAGGTGCTGCGCGAC
TTGCAGTGGCTGTTCAACACCATTAACAACGAAGCGCAGCAGGATCTGAGCCGGGTGGACCACGTGCGCC
GCTCGGTCTTTAACTTCGGCGTGGCGCCGCTTGCGGGCAAGCGGATGTCGGAAATTGAGTGGGGCGACAT
CCAGCAGCGGCTCACCGAGGCGATTTTGCACTTCGAGCCGCGCATTCTGCCGCAGGGGTTGCAGGTGCGC
TGCGTCTGCGACACCAAATCGCTCGACCTGCACAACGTATTATCGATTGAGATTAAAGGCCGCCTGTGGT
GTGTGCCCTGGCCGCTTGAGTTCCTGTTCCGCACCGATGTGGATCTGGAAAACGGCCATTTTGAGCTTAA
AGACGCGGGGTAA