SecReT6
Protein ID: 449310129
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18165
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3887844..3888677 [-]
Producthypothetical protein
NoteTagJ
UniProt IDM1JZQ6
KEGG IDcsz:CSSP291_18165
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.90E-44, Aligned region: 146..268
Protein Sequence: 277 a.a.     [Download]
>gi|449310129|ref|YP_007442485.1| hypothetical protein CSSP291_18165 [Cronobacter sakazakii SP291]
MNTLYQQLAGASVSDALSRLEADIKAQPGNADRRAAFVQFLCLNANWTRALTQLKSWAALAPQAQPTVTL
LQQAIEGEQQRAEVLAGRARPRMPGEQWPWLDLLLKALAETDPARASELRSEALEQAEANPGELTLAVGD
APGEPVHFDWLMDGDARLGPVCELIVNGNYFWVPFSAIASIRFQAPASVTDLVWRHAMVQLVDGTEQVCQ
IPARYPLETGADDRFLLARTTEWQPLDAEGIHYLGAGQKVWLSGEQEFALLTLDMLAFGLPDDASHE
 
Nucleotide Sequence: 834 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3888677-3887844 Cronobacter sakazakii Sp291, complete genome
ATGAACACGCTGTATCAACAACTGGCTGGCGCGAGCGTCAGCGACGCGCTGAGCCGTCTTGAGGCCGATA
TCAAAGCCCAGCCGGGCAACGCCGATCGCCGCGCCGCGTTTGTGCAGTTTCTCTGCCTGAACGCCAACTG
GACCCGCGCGCTCACCCAGCTGAAAAGCTGGGCCGCGCTGGCACCGCAGGCGCAGCCGACCGTGACGCTG
CTGCAACAGGCCATCGAAGGCGAGCAGCAGCGCGCCGAAGTGCTGGCAGGCCGCGCGCGTCCGCGTATGC
CGGGCGAACAGTGGCCGTGGCTGGATCTGCTGCTGAAAGCGCTGGCGGAAACCGACCCGGCGCGCGCCAG
CGAGCTTCGCAGCGAGGCGCTGGAACAGGCCGAAGCCAATCCGGGCGAGCTGACGCTGGCGGTGGGCGAC
GCGCCCGGCGAGCCGGTGCATTTTGACTGGCTGATGGACGGCGACGCGCGTCTGGGGCCGGTGTGCGAGC
TTATCGTTAACGGCAACTACTTCTGGGTGCCGTTCAGCGCTATCGCGTCGATTCGTTTCCAGGCTCCGGC
GAGCGTCACCGATCTGGTGTGGCGTCACGCGATGGTGCAGCTGGTGGACGGCACCGAACAGGTCTGCCAG
ATCCCGGCGCGCTACCCGCTGGAAACCGGCGCGGACGACCGCTTCCTGCTGGCGCGCACCACCGAGTGGC
AGCCGCTGGACGCGGAAGGCATTCACTATCTCGGCGCGGGTCAGAAAGTCTGGCTGAGCGGCGAACAGGA
GTTCGCGCTGCTGACGCTGGATATGCTCGCTTTCGGGCTGCCGGACGACGCATCGCATGAATAA