SecReT6
Protein ID: 449310132
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18180
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3890517..3892433 [-]
Producttype VI secretion system FHA domain-containing protein
NoteFha
UniProt IDM1J0K6
KEGG IDcsz:CSSP291_18180
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.80E-08, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0034, Aligned region: 29..49
UreE_N [PF02814], Evalue: 0.0034, Aligned region: 78..99
Protein Sequence: 638 a.a.     [Download]
>gi|449310132|ref|YP_007442488.1| type VI secretion system FHA domain-containing protein [Cronobacter sakazakii SP291]
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGECRITNRGNVTR
VVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPNVAPQQPQAPQPAKPQQPPKA
DAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKTPEAQPFNPFNAPKEADRNPEDPLAHFQSGG
NEPLFGNERVNPDSLFKDDTPFDKDSIFNDVTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGS
TPVQSRSDDPLGLMMGGAVPLTPPDELNAGAAPLTPPPAAKQDAEPVKPPVSPEKPQPEMTTSPLAPNAD
DSIDLASLAASPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDPVQSPT
SQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALLSSRSILKRGV
KADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDLQAHQLGMIAGIRAIIAAMLQ
SFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSDTAGEIEDDFHTLFGEAFLHAYDMEVNQYKD
SQSGSEEE
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3892433-3890517 Cronobacter sakazakii Sp291, complete genome
ATGCGATTCACGATTACTACCAACAAGCCCGGCCACCAGCCTCCTCAGAGCAGCTGTGACTTCTACCCGC
CGGGCGGCACGATTGGCCGTGGTACGGATAACAATCTGGTACTGCCGGATAATGAAAGAACGATTTCCCG
CCTGCAGGCGATTGTCCATATCTCCGCGGACGGCGAGTGCCGCATCACTAACCGCGGCAACGTGACCCGC
GTGGTGCTGAACGATATTCCGCTCGAGCGCGGCCGCCAGGTGGAGTTACAGGATGGCGACGTGCTCGGCA
TTGACGATTACCGCATCCAGGTCAGCGATCTGGCGCTGAACGCGCAGCCGGTTATCGCGATGGCCGCGCC
GAAACCGAACGTTGCGCCGCAGCAGCCTCAGGCACCGCAGCCTGCGAAACCGCAGCAGCCGCCGAAAGCC
GACGCGCAGGACAACGCGCCAACGGCGGTGCCGACCGAAATCTGGGACAGCCTGATGCAGGAGTTCTCTA
TCTCCGACAGCATCAGCCAGGGTCAGAGCCAGAGCGCGCGCCCGAAAACACCGGAAGCGCAGCCGTTTAA
CCCGTTCAACGCCCCGAAAGAGGCGGATCGCAACCCGGAAGATCCGCTGGCGCACTTCCAGAGCGGCGGC
AACGAGCCGCTGTTCGGCAATGAAAGGGTCAACCCGGACAGCCTGTTCAAAGATGACACGCCGTTCGATA
AAGACAGCATTTTCAACGATGTGACGCCGACCACGCTGGTGCCGCCGTCTGATAACCGTCAGGCCGCAAA
ACCGCAGGCACCGCATAAAGAGAATGAAGAAGAGCTCGATCCGCTGGCGCTGTTTGGCGGCGTGGGTTCC
ACGCCGGTACAGAGCCGCAGCGACGATCCGCTTGGCCTGATGATGGGGGGCGCTGTGCCGCTGACGCCGC
CGGATGAGCTTAACGCAGGCGCTGCGCCATTAACGCCGCCGCCCGCCGCGAAGCAGGACGCCGAGCCGGT
TAAGCCACCGGTTTCACCCGAAAAACCGCAGCCGGAGATGACGACCTCGCCGCTCGCGCCAAACGCGGAC
GACTCAATCGATCTGGCGTCGCTCGCCGCTTCGCCGCTATTCCCGGAAGAAGTGCCGGAAGAGCCGGTGA
CGCGCGTGGAAGTCCAGCCGACGCCGCCGGAAGTGCAGGATTACGCGGGTATCACGCTGCCGACGCCGCA
GGCGGTGGCGCGCAGCACCGCGCAGACGCCAAAAGGCCGCCTGCGCATCGACCCGGTGCAGTCGCCAACC
AGCCAGGGCGGCACACCGACGGCGTCTAACGGCGACGTGCTGAACGGCGAGCTGCTGGAAGCATTGCTGG
AAGGTATGGGGCTTGGCGAGCTGCAACCAACGCCGCAGTTTGACCGCGACAATATGCGCCAGCTCGGCCA
GATGCTCAGCATGTTCTCGCAGGGCACCGTGGCGCTGCTCTCCTCGCGCTCGATTCTCAAGCGCGGCGTG
AAAGCCGATATGACGATGGTGCTGGACGACGCCAACAACCCGTTCAAGCTGCTGCCGTCAGGCAAAACCG
TGCTGATGCAGATGTTCGGCACCCGTATGCCGGGCTTTATGCCGCCGAAAAAATCGGTGCGCGACGCGCT
TATCGATCTTCAGGCGCACCAGCTCGGGATGATCGCCGGTATCCGCGCCATCATCGCCGCCATGCTGCAA
TCCTTTAACCCGGAGCAGCTTGAAGAAGAGGCGAAACGCGACGGCGCTATCTCGCGTCTGGCGCTGCCGG
CGAGCCGCAAAGCCGCGCTGTGGGATTACTTTGTGCGTCATTACAGCGATACCGCGGGCGAGATCGAGGA
CGATTTCCATACTCTGTTCGGCGAAGCCTTCCTGCACGCTTATGACATGGAAGTGAATCAGTACAAAGAC
TCACAAAGCGGATCGGAAGAAGAATGA