SecReT6
Protein ID: 449310136
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18200
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3894798..3895280 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDM1JK45
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.90E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|449310136|ref|YP_007442492.1| Hcp1 family type VI secretion system effector [Cronobacter sakazakii SP291]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTA
TGGKGAETSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3895280-3894798 Cronobacter sakazakii Sp291, complete genome
ATGGCTATTGATATGTTCCTGAAAGTAGACGGTGTAACCGGCGAATCTAAAGATTCCAACCACACCGGCT
GGACCGACATCACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGAATTTCAACGATCTGCACGTTAACGCGCTGATCGACAAATCCACCACCGCTATCCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCGGGCGGCCAGCAGG
TGGAATACACCCGTATCACTCTGGAAGATGTGCTGGTGACTTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTTGGCGTTACTTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTGCG
ACCGGCGGTAAAGGCGCAGAAACCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA