SecReT6
Protein ID: 449310139
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18215
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3896775..3898274 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDM1JZR3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|449310139|ref|YP_007442495.1| type VI secretion system protein ImpC [Cronobacter sakazakii SP291]
MSNPSQQQELQSQQAFSQDEFSALLSKEFRPKTDQARSAVENAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEKLSQQVNQIIHHEEFQKLESAWRGLNYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHSNYNWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLIHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3898274-3896775 Cronobacter sakazakii Sp291, complete genome
ATGAGCAATCCTTCTCAACAGCAAGAGCTGCAATCGCAGCAGGCGTTCAGCCAGGATGAATTCAGCGCGC
TGCTCAGCAAAGAGTTTCGCCCGAAAACCGACCAGGCGCGTTCGGCCGTCGAAAACGCGGTAAAAACCCT
GGCCCAGCAGGCGCTGGAAAATACCGTGACCTTCTCGAACGACACCTACCGCACCATTCAGAACCTGATT
GCCGGTATCGACGAGAAACTGTCTCAGCAGGTTAACCAGATTATTCACCACGAGGAGTTCCAGAAGCTGG
AAAGCGCCTGGCGTGGCCTGAACTATCTGGTCAACAACACGGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAACTGGGCCGCACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGC
CCTATCTTCAAAAAAATCTACGAAGAAGAGTATGGCCAGTTCGGTGGCGAGCCGTTTGGCTGCCTGGTGG
GCGACTACTACTTCGACCACAGCCCGCAGGATGTTGAGCTGCTGAGCGAAATGGCGCGCATCGGCGCGGC
GGCGCACTGCCCGTTCATCACCGGCACCGCGCCGAGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCG
AACCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAGTACGCTGCCTGGCGCAGCCTGCGCGAGTCGG
AAGATGCGCGTTATCTGGGCCTCGTCATGCCGCGCTTCCTGTCGCGCCTGCCATACGGCATTCGCACCAA
CCCGGTGGACAGCTTCGACTTCGAAGAAGAGACCGACGGCGCGAACCACAGCAACTACAACTGGGCTAAC
GCGGCCTACGCGATGGCGGCCAACATCAACCGTTCCTTTAAAGAGTACGGCTGGTGCACCTCCATTCGCG
GCGTGGAATCGGGCGGCGCGGTAGAAAACCTGCCGTGTCACACCTTCCCGAGCGACGACGGCGGCGTGGA
TATGAAATGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAAGCGGAACTGGCGAAAAACGGCTTTATG
CCGCTGATTCACCGCAAAAACTCCGACTTCGCCGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCGG
AATACCACGACCCGGACGCCACCGCGAACGCCCGTCTGGCGGCGCGTCTGCCGTACCTGTTCGCCTGCTG
CCGTTTCGCGCACTACCTCAAGTGCATCGTTCGCGACAAGATCGGTTCTTTCCGCGAGCGCGATGAAATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTGGACGGCGACCCGGCGAACTCCTCTCAGGAAACCA
AATCCCGCAAGCCGCTGGCCGCGGCCGAGGTGCAGGTTCAGGAGATCGAGGACAACCCGGGCTACTACGC
CGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTGACCGTTTCTCTGCGTCTGGTCTCCAAA
CTGCCGTCGCTGAAGAGCAACGAGGCGTAA