SecReT6
Protein ID: 449310140
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18220
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3898278..3898796 [-]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDM1JP16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-60, Aligned region: 9..162
Protein Sequence: 172 a.a.     [Download]
>gi|449310140|ref|YP_007442496.1| type VI secretion system protein ImpB [Cronobacter sakazakii SP291]
MSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPAVDERKFLEIDIDNFDE
RMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKNGA
EELIAKVLQDPTLLKSLSQMPKDDDGTKGNEE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3898796-3898278 Cronobacter sakazakii Sp291, complete genome
ATGAGTAACAGTGGGCAGAAATTTATCGCCCGTAACCGCGCGCCGCGCGTGCAGATCGAGTACGACGTGG
AAATCTACGGTGCGGAACGCAAAATTCAGCTTCCGTTTGTAATGGGCGTGTTTGCCGACCTGGTCGGGAA
GCCGGTCGATCCGCAGCCTGCGGTGGACGAACGTAAATTCCTTGAAATTGATATCGACAACTTCGACGAG
CGTATGAAAGCGCTCAAGCCGCGCGTGGCGTTCCAGGTGGACAACACCCTGACCGGCGAAGGCAAACTGA
ACATCGATCTCACTTTCGACAGCATGGACGACTTCCTGCCGGACGCCGTCGCGCGTAAGGTCGAGCCGCT
GAACAAGCTGCTGGAAGCCCGTACTCAGCTCTCTAACCTGCTGACCTACATGGACGGTAAAAACGGCGCC
GAAGAGCTTATCGCGAAAGTGCTTCAGGACCCGACGCTGCTCAAATCGCTGAGCCAGATGCCGAAAGATG
ACGATGGCACCAAAGGTAACGAGGAGTAA