SecReT6
Protein ID: 449310141
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18225
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3898878..3899900 [-]
Producthypothetical protein
NoteTssA
UniProt IDM1JK50
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.10E-21, Aligned region: 52..111
Protein Sequence: 340 a.a.     [Download]
>gi|449310141|ref|YP_007442497.1| hypothetical protein CSSP291_18225 [Cronobacter sakazakii SP291]
MDIETLLTPVSPEQPCGDNLEYDADYQAMEQASQGKAEQQFGDTIIPAEPADWTKVEKLALSLLERTKDL
RVMLALTHAWTKRRGLPGYADGLLLIQEALTRYWEPLYPLLEEYGEKDPFYRINALAGLGDKSSLTSTLR
TATLLRSNGDEITLRDAQSLLDNSKSECPGYPGGRPRLVDELARGGQPGIEAIVQIHARLEAIRTILVSH
LGESGVPEMEQLQKLTSIVALACQSGETQAPQELQDPDVQAENAPAATTTSAPARVVETDWRNVQLQTRD
DAQLMLEKVKQYFARHEPSHPAPLMIERVQRLIEMNFMDLIRDLAPDSVHQVENIFGRRE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3899900-3898878 Cronobacter sakazakii Sp291, complete genome
ATGGATATTGAAACCCTTCTTACTCCGGTGAGCCCGGAGCAGCCGTGCGGCGACAACCTGGAGTACGACG
CCGATTACCAGGCGATGGAGCAGGCAAGCCAGGGCAAGGCGGAACAGCAGTTCGGCGACACCATTATTCC
GGCAGAGCCGGCGGACTGGACTAAAGTTGAAAAGCTGGCTCTGTCGTTGCTTGAGCGCACCAAAGATCTG
CGCGTCATGCTGGCGCTGACCCACGCATGGACCAAACGCCGCGGCCTGCCGGGCTATGCCGACGGGCTGC
TGCTGATTCAGGAAGCGCTGACGCGCTACTGGGAGCCGCTCTATCCGCTGCTGGAAGAGTACGGCGAAAA
AGATCCGTTCTACCGAATTAACGCGCTGGCGGGGCTTGGCGATAAATCCTCCCTGACCAGCACGCTGCGC
ACCGCGACGCTGCTGCGCAGCAACGGCGACGAAATTACGCTGCGCGACGCGCAGTCGTTGCTCGACAACA
GCAAAAGCGAATGTCCGGGTTATCCGGGCGGTCGCCCGCGGCTGGTGGATGAACTCGCGCGCGGCGGCCA
GCCGGGCATCGAGGCGATAGTCCAGATCCACGCGCGACTGGAAGCGATTCGCACCATTCTGGTCAGCCAT
CTCGGTGAGAGCGGCGTGCCGGAGATGGAGCAGCTCCAGAAGCTGACGAGCATTGTGGCGCTGGCCTGCC
AGAGCGGCGAAACCCAGGCGCCGCAGGAGTTACAAGACCCGGACGTGCAGGCGGAGAATGCGCCTGCCGC
CACGACGACCAGCGCCCCGGCGCGGGTGGTTGAAACCGACTGGCGCAACGTGCAACTGCAAACGCGCGAT
GACGCCCAGTTAATGCTTGAGAAAGTGAAGCAATATTTTGCCCGGCACGAGCCGAGCCACCCCGCGCCGC
TGATGATTGAGCGCGTGCAGCGACTGATTGAAATGAATTTCATGGATCTTATTCGCGACCTGGCGCCCGA
CAGTGTGCATCAGGTGGAAAACATTTTCGGACGCCGCGAGTAA