SecReT6
Protein ID: 449310145
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18245
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3905512..3906855 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDM1JP20
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-143, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|449310145|ref|YP_007442501.1| type VI secretion system protein ImpJ [Cronobacter sakazakii SP291]
MNKAEKVVWTEGMFLRPHHFQRAESFLQHHIREWGSLQRPYLWGFLDLEFDEAMLRQGRVALSYASGLLP
DGTPFSFRDARHGPAPLAIPDNLTHERVVLALPARRAGREEVIFSEAADSLARYATFEEEVEDDNALSVG
AATVQFGRLRLKLMLESELTAEWTAIGVAQVIEKRNDNQVRLDTSYIPPMLNAINSGQLYSMLNDLHGLL
GQRSQQISQRLRQPGRFNTSEMVEFMLLSLINHHLGHVTHLKTLPLLHPETLWRDWLAFACELTTWTAQR
APETTLPVYDHDNLAGCFGKLTLMLRQGLSLVMEESAIQLPLTERSHGLNVATVPESNMVREFGFVLAVK
ANVPGEALQTHFPAQMKVAPVTKIRDLVQLQLPGMVLRAMPVAPPQIPWHAGYSYFELEKGGELWKEMEK
SGAFALHLAGEFPGLDMEFWAIRSTNE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3906855-3905512 Cronobacter sakazakii Sp291, complete genome
ATGAACAAAGCAGAAAAAGTGGTCTGGACCGAAGGGATGTTCCTGCGTCCGCACCACTTCCAGCGCGCGG
AAAGTTTTCTGCAACACCACATCCGCGAATGGGGTTCGTTGCAGCGTCCGTATCTCTGGGGATTTCTCGA
TCTGGAATTTGACGAGGCGATGCTGCGTCAGGGACGCGTGGCGCTGAGCTACGCCAGCGGCCTGCTGCCG
GACGGCACGCCGTTCTCTTTCCGCGACGCCCGCCACGGCCCGGCGCCGCTCGCCATTCCTGACAACCTCA
CGCACGAGCGCGTGGTGCTGGCGCTGCCTGCCCGCCGCGCCGGACGCGAAGAGGTGATTTTCAGCGAGGC
GGCCGATTCGCTCGCCCGCTACGCCACCTTTGAAGAAGAAGTGGAAGACGACAACGCGCTGTCGGTCGGC
GCGGCGACGGTACAGTTTGGCCGCCTGCGTCTCAAGCTGATGCTGGAGAGCGAACTGACCGCCGAGTGGA
CGGCCATTGGCGTCGCGCAGGTGATTGAAAAGCGCAACGACAACCAGGTGCGCCTCGATACCAGCTACAT
TCCGCCGATGCTCAACGCCATCAACAGCGGGCAACTCTACAGCATGCTCAACGATCTGCATGGTCTGCTC
GGTCAGCGCAGCCAGCAAATCAGCCAGCGTCTGCGCCAGCCGGGGCGGTTTAACACCTCGGAGATGGTGG
AGTTCATGCTGCTGTCGCTGATTAACCATCATCTCGGCCACGTCACGCATTTAAAAACGCTGCCGCTGCT
CCACCCGGAAACCCTGTGGCGTGACTGGCTGGCGTTCGCCTGCGAACTCACCACCTGGACGGCGCAGCGC
GCGCCGGAGACGACGCTGCCGGTCTATGACCACGACAACCTGGCGGGCTGCTTTGGCAAACTGACGCTGA
TGCTGCGCCAGGGTCTGTCGCTGGTAATGGAAGAGAGCGCCATTCAGCTGCCGCTCACCGAGCGTTCGCA
CGGGCTCAACGTCGCCACCGTGCCGGAAAGCAACATGGTGCGCGAGTTCGGTTTCGTGCTGGCGGTCAAA
GCCAACGTGCCGGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTCACCAAAA
TTCGCGATCTGGTGCAGTTGCAGTTGCCGGGTATGGTGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCGTGGCATGCCGGCTACAGCTATTTCGAACTGGAAAAGGGCGGCGAACTCTGGAAAGAGATGGAGAAA
TCCGGCGCGTTTGCGCTGCATCTCGCTGGTGAATTCCCGGGCCTTGATATGGAGTTTTGGGCCATTCGCA
GTACGAATGAATAA