SecReT6
Protein ID: 449310146
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18250
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3906880..3907386 [-]
Producttype VI secretion lipoprotein, VC_A0113 family 2
NoteTssJ
UniProt IDM1JK55
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-32, Aligned region: 20..159
Protein Sequence: 168 a.a.     [Download]
>gi|449310146|ref|YP_007442502.1| type VI secretion lipoprotein, VC_A0113 family 2 [Cronobacter sakazakii SP291]
MKNRTVLRQGFLAFLIAALTLLSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADF
FSLQNNAQTVLGANLLNSDEFFLMPGQLNKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPSDSS
IYKFWKWSSDELEAKVFLDVNGIRVINE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3907386-3906880 Cronobacter sakazakii Sp291, complete genome
ATGAAAAACCGTACCGTTTTACGCCAGGGCTTCCTGGCGTTTTTGATTGCCGCTCTCACCTTACTGAGCG
GCTGCTTATCGTCTTCACGCAGCGTTCCTTCCCAGTACAGCCTGCATTTTCAGGCTCACCCGCAAATTAA
TAATTCCGCCCCGCTAAAAGTCCGGGTGCTGCTTTTGAAATCAGACGCCGACTTTATGTCTGCGGATTTC
TTTTCGCTGCAAAACAATGCTCAGACCGTGCTGGGAGCCAACCTGCTCAACAGCGACGAGTTCTTCCTGA
TGCCGGGCCAGCTGAACAAAACCCTCAGCGGCCAGAGCTCGCTTGATGCGCGCTACATCGGCGTGATGGC
GGAATATCAGGCGCTCGACGGCAAAAAATGGCGAATCTCGCTCCCGCTGCCCGCCCCCAGTGACTCCAGC
ATTTATAAATTCTGGAAATGGTCATCTGACGAACTTGAGGCAAAAGTGTTTCTTGACGTCAATGGGATCC
GCGTCATCAACGAATAA