SecReT6
Protein ID: 451948283
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02689
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]2995681..2996703 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDM1PI00
KEGG IDdsf:UWK_02689
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-24, Aligned region: 29..93
FHA [PF00498], Evalue: 7.30E-24, Aligned region: 201..260
Protein Sequence: 340 a.a.     [Download]
>gi|451948283|ref|YP_007468878.1| FHA domain-containing protein [Desulfocapsa sulfexigens DSM 10523]
MNIPDKKVQLVHLNGPFKGEIQDFFESVIVIGRHPDCQLVFPSDSTAISRKHAEIRREGNRFKFLDYSAN
GTLINGIEQKDVFLKDGDVLIIGGEGGPKVSFLSSKVTPEEKEAIASSGDMNRQQDPSVSLSPPDKVQTP
KIEESPENVPLAQSLQKSPVIEPLPSSSMKGPRDSAPIPTVNKSFIIQYGATLTSFKKLPIIIGSGSDCD
CTLQHHALLDHHAQIFFRDNQYWVKDLTGRGMLTVNLRPVQSESSLQPDTCLALTPQGPKFQFLGEGRLA
EIETTEESEKRLEPVQSDKYQQQQSRGSSVKPSGGGKKLFWILFTLLLVLGIPIAVWYFL
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|451945650|ref|NC_020304.1|:2995681-2996703 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGAATATCCCAGATAAAAAAGTACAGTTAGTGCATCTGAACGGGCCGTTTAAAGGTGAAATTCAAGATT
TCTTTGAATCGGTTATTGTTATTGGGAGACATCCTGATTGCCAGCTGGTCTTTCCGAGTGATTCCACAGC
AATTTCACGGAAACATGCTGAAATTAGACGGGAGGGGAACCGCTTCAAGTTTCTGGATTACAGCGCAAAT
GGTACCCTGATCAATGGTATAGAGCAAAAAGATGTTTTTTTAAAAGATGGTGATGTGCTGATTATTGGTG
GAGAGGGAGGGCCAAAGGTCAGTTTTTTGAGTTCAAAAGTTACTCCCGAAGAAAAGGAGGCCATTGCTTC
TTCTGGAGATATGAATAGACAGCAGGATCCAAGTGTATCGCTGTCACCGCCTGATAAGGTGCAGACACCT
AAAATAGAAGAGTCGCCTGAAAATGTTCCGCTAGCTCAGTCTCTGCAGAAATCACCAGTGATAGAACCTT
TGCCATCGTCATCGATGAAAGGTCCTCGAGATTCTGCGCCGATTCCTACAGTTAATAAAAGCTTTATCAT
CCAGTATGGGGCAACCCTTACCTCCTTTAAGAAGTTACCAATCATCATCGGGAGTGGCAGTGATTGTGAC
TGTACATTGCAGCATCATGCTCTGCTTGACCACCATGCACAGATTTTCTTCCGGGACAATCAGTACTGGG
TGAAAGACCTTACCGGCCGTGGAATGCTGACGGTCAATTTACGACCGGTTCAGTCTGAATCATCGCTTCA
GCCAGATACCTGTCTGGCCCTCACACCTCAGGGGCCTAAGTTTCAATTTCTTGGCGAAGGCAGGCTAGCT
GAAATTGAGACAACGGAAGAATCGGAAAAGAGACTGGAACCAGTGCAATCAGACAAGTACCAGCAACAGC
AATCAAGAGGATCCAGTGTCAAACCATCCGGAGGCGGCAAAAAGCTGTTCTGGATTCTGTTTACTCTGCT
GCTTGTACTCGGGATTCCAATAGCAGTCTGGTATTTCCTGTAA