SecReT6
Protein ID: 451948284
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02690
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]2996794..2998362 [+]
Producthypothetical protein
NoteTssC
UniProt IDM1PS86
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-31, Aligned region: 171..476
DUF770 [PF05591], Evalue: 0.0047, Aligned region: 10..93
Protein Sequence: 522 a.a.     [Download]
>gi|451948284|ref|YP_007468879.1| hypothetical protein UWK_02690 [Desulfocapsa sulfexigens DSM 10523]
MEQISIPDFPFSILALAPFTSEVNPGVTVKLLAVDPLDIDQALTALMPSFFLSLPVAECPAGGLHLRFRK
MRDFTPDGLLQSQPYLENLLAAHRFCLEAEQQKKSTEVIIEGVKKWPDLPPISLTQKKKDEEEKKSSLES
ILSMVALPEEDSSVKGATAGGTGFYGALARKILDSIYTDPIFRSLESCWQGLRYLGRHLAEAGGRLSILP
ISHNNIEKVLDEQREEIILDPPSVILVDQPLSSSERSVQMMTQLASFGQEMLVPVLTWLDASFFQIENWK
NLDSLSFLPHHLEKASFARYKGLQNSDLSRWIGLSCNRFGTRFPYGPENRSRLLPFREKEMLWLSSVWGV
AALMASRVRQTGWPTGMASSRQICLEDLALALEGSVEQSPLEVQWSESRLEQVSRCGIMALAGWKGRDSA
FLAGDVMASTDSSLSYQTLLCRVSHFILWCRDNWQEPLLADELASRLHTAFQLFTKKQGEYPVGDFGVEC
HDDKGAIQVLFRWIPSRHILPSGQEIVLEFGW
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|451945650|ref|NC_020304.1|:2996794-2998362 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGAACAGATATCTATTCCAGATTTCCCTTTTTCCATTCTTGCACTTGCACCGTTTACTTCAGAAGTAA
ATCCTGGTGTGACCGTCAAACTTCTTGCAGTTGATCCTTTGGATATTGATCAGGCACTAACTGCGTTGAT
GCCATCTTTTTTTCTCTCTCTCCCAGTTGCAGAATGTCCTGCCGGTGGGCTTCATCTTCGATTCAGGAAA
ATGCGCGATTTCACCCCTGACGGTCTTTTGCAGAGTCAACCATATCTTGAGAATTTGCTTGCCGCTCATC
GTTTCTGCCTTGAGGCTGAACAGCAAAAGAAGTCTACAGAGGTAATTATTGAAGGAGTTAAGAAGTGGCC
TGATCTACCCCCGATCTCACTGACTCAGAAAAAAAAGGACGAGGAAGAAAAAAAGAGTTCCCTGGAGAGT
ATTTTATCCATGGTGGCTTTGCCGGAAGAAGACAGTTCAGTCAAGGGAGCCACTGCAGGAGGAACTGGAT
TTTATGGCGCACTGGCCCGTAAAATTCTAGACAGCATCTATACCGATCCAATATTTCGATCCCTTGAGTC
CTGCTGGCAGGGTTTGCGATATCTCGGTCGCCATCTTGCTGAGGCTGGTGGTCGTTTGTCAATATTACCG
ATATCTCATAATAACATTGAAAAAGTCCTGGATGAACAAAGAGAAGAGATCATACTTGATCCTCCTTCTG
TCATTCTTGTTGATCAGCCCTTAAGCAGTTCAGAGAGATCCGTGCAAATGATGACTCAGCTCGCTTCCTT
TGGCCAGGAGATGCTTGTACCTGTGCTTACCTGGTTGGATGCTTCGTTTTTCCAGATTGAAAATTGGAAG
AATCTTGATAGCCTTTCTTTTCTTCCCCACCACTTGGAAAAAGCATCCTTTGCCAGGTATAAAGGTTTGC
AGAATTCCGATTTGAGTCGCTGGATAGGGTTGAGCTGCAATCGTTTTGGGACTCGTTTCCCCTATGGGCC
TGAGAACCGATCACGCCTTCTTCCTTTCAGGGAAAAGGAGATGCTCTGGCTCTCTTCGGTATGGGGAGTT
GCAGCTCTTATGGCTTCCCGCGTAAGGCAAACCGGATGGCCAACGGGTATGGCCTCATCACGGCAGATCT
GTCTGGAAGATTTGGCTCTTGCCCTGGAAGGTTCGGTTGAACAAAGTCCGCTTGAGGTACAATGGAGTGA
AAGTCGGCTGGAACAGGTTTCCCGTTGCGGCATTATGGCGCTGGCCGGATGGAAGGGAAGGGATAGCGCT
TTTCTTGCCGGTGATGTCATGGCCTCGACGGATAGTAGTTTGAGTTATCAGACCTTGCTTTGCAGAGTGA
GCCACTTTATCCTCTGGTGTCGGGACAATTGGCAGGAACCTTTGCTGGCAGATGAATTGGCTAGTCGATT
GCACACTGCCTTTCAACTGTTTACCAAAAAACAGGGGGAGTATCCTGTTGGTGATTTTGGGGTGGAGTGT
CACGATGATAAAGGGGCTATTCAGGTCTTGTTTCGATGGATCCCTTCCAGGCACATTCTCCCCAGCGGAC
AGGAGATAGTGCTGGAGTTTGGCTGGTAA