SecReT6
Protein ID: 451948287
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02693
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]2999988..3001454 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDM1NI12
KEGG IDdsf:UWK_02693
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.00E-16, Aligned region: 38..100
SLT [PF01464], Evalue: 1.20E-11, Aligned region: 315..437
Protein Sequence: 488 a.a.     [Download]
>gi|451948287|ref|YP_007468882.1| FHA domain-containing protein [Desulfocapsa sulfexigens DSM 10523]
MIQRLENNGQNSSPPAVLVSATWPAGQFAERAFSSSFRVGRDPDCDIAITDPVVSRHHAEVIFLADTWWI
QDCNSANGIFVDGNRVNRIAIKKLTRIELGRNGPLLTLSVDQPFQETKKPGTPRSMSHYQEHYFGDKDDG
DAGEHTIMVRRAFAQVQKKQKRKYGIIIGLVTCLFCIAGSVAIYMHLQVEKQKKLAAEIFYTMKGLEVEF
ADVLQTARDSDDTATIARVEYYKQQARELENSYSEFVDTLGIYKNISPQEEAILKTARIFGECEIFVPAD
FTSEVIRYIKKWQSSSRLVNALERAENNGYTSPIARTMRYYFLPPQFFYLALQESNFNVNALGPKTRWGI
AKGMWQFIPETGSRYGLQTGPLFKQRKVDPLDERHNFAKSTVAAAKYLRKIYDTDAQASGLLVMASYNWG
ENRVIQLVRDMPNNPKERNFWQFFKQYRDKIPEQTYDYVFYIFSAAVIGENPGLFGFDFDNPLIIAAK
 
Nucleotide Sequence: 1467 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3001454-2999988 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGATTCAAAGGCTGGAAAATAACGGGCAGAATTCGTCACCTCCAGCTGTTTTAGTCTCAGCAACATGGC
CAGCCGGACAGTTTGCAGAACGCGCATTTTCCTCCTCTTTTCGTGTCGGTCGTGATCCCGACTGTGATAT
AGCTATTACCGATCCGGTAGTCAGTCGCCACCATGCCGAGGTAATTTTTCTGGCAGACACCTGGTGGATT
CAAGACTGTAATAGTGCCAATGGTATTTTTGTTGACGGTAACCGGGTTAATCGCATTGCCATTAAAAAAC
TGACCAGGATTGAACTGGGAAGAAACGGGCCACTCCTTACACTGTCGGTTGACCAGCCTTTCCAGGAAAC
TAAAAAGCCTGGAACTCCACGATCCATGTCCCACTATCAGGAACATTATTTCGGTGATAAGGATGACGGG
GACGCAGGTGAGCACACCATAATGGTTAGACGTGCCTTTGCCCAGGTTCAGAAAAAACAGAAAAGAAAGT
ATGGTATCATCATTGGCCTGGTTACCTGCCTTTTTTGTATTGCTGGCTCAGTTGCCATCTACATGCATCT
GCAGGTTGAGAAACAAAAAAAACTCGCTGCTGAAATCTTCTATACCATGAAAGGACTGGAAGTAGAGTTT
GCAGATGTTCTTCAAACAGCACGAGACAGTGATGACACTGCTACCATTGCCAGGGTAGAATATTATAAAC
AGCAGGCAAGAGAGTTGGAAAACAGCTATAGCGAATTTGTCGACACTCTCGGGATCTATAAAAATATCAG
TCCCCAGGAAGAGGCAATTCTAAAAACTGCGAGAATTTTTGGTGAATGTGAAATATTTGTTCCTGCTGAC
TTTACCAGTGAAGTCATACGCTACATCAAGAAGTGGCAGTCAAGCAGCCGTCTTGTTAACGCCCTGGAAC
GCGCAGAAAACAATGGCTACACTTCTCCAATTGCCAGAACCATGCGCTATTATTTTCTCCCACCACAGTT
CTTTTATCTGGCTCTGCAGGAAAGTAATTTTAACGTAAATGCCCTGGGCCCTAAAACCCGCTGGGGTATT
GCCAAAGGTATGTGGCAATTCATTCCTGAAACCGGCTCTCGATATGGCCTGCAAACAGGTCCCCTTTTTA
AGCAACGAAAGGTAGATCCCCTTGACGAGCGGCATAATTTTGCCAAATCAACCGTGGCCGCAGCAAAGTA
CCTGCGAAAAATTTACGATACCGATGCTCAGGCCTCCGGGCTATTGGTAATGGCCTCGTACAACTGGGGA
GAAAACCGCGTTATTCAACTTGTGAGAGATATGCCGAATAATCCAAAAGAACGTAATTTCTGGCAGTTTT
TTAAACAGTATCGTGATAAAATACCCGAACAAACCTATGACTATGTGTTCTACATTTTTTCAGCGGCAGT
GATTGGAGAAAACCCCGGTCTCTTTGGCTTTGATTTTGACAATCCGCTCATTATTGCGGCAAAATAG