SecReT6
Protein ID: 451948292
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02698
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3006204..3008492 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDM1NI19
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-71, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 2.10E-17, Aligned region: 394..469
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 469..477
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 534..556
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 570..583
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 594..605
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 640..662
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 656..675
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 698..704
Protein Sequence: 762 a.a.     [Download]
>gi|451948292|ref|YP_007468887.1| Rhs element Vgr protein [Desulfocapsa sulfexigens DSM 10523]
MPVEENIRFIFTSTSQPDDTFTVAEFNGTEAISKLYEFDITLYADDPDINLKEVLKNPVKLRIEKNGEEL
RVFHGILSRFEQLHEYSGHIYFRAILVPRLWISDQYLENQLFLDKSIPDIIEEVLKQTGLTTHDYELKLT
GNYAPWEYICQYNESDFNFISRWMEREGIYYYFQQGDDAEKLIIADASTAHEDIPSGESIRYSPPDSLSP
STTEQVREFTCHQHLLPKKVILKDYNYRKPSLDLKGEADVDTEGRGHVYIYGEHFKTPEEGNALARIRAE
EILCREAIFYGEGTVPPFLAGYIFEMHDHYRDSYNQRYLITELSHQGVQSTYLTGTGDTVEETDMQGPSY
FNNFTCIPADAQFRPERLAEKPKLKGTLNGTVDAGGDGEYAEIDDEGRYKIKLPFDQSDSADGKASRWVR
MAQPYAGADYGMHFPLHKGTEVLLTFIDGDPDRPIISGTVPNPETGSPVTGSNQTQSMIRTAGGNQIRIE
DSNGGQQIHMSSPTKGSIVSLGAVNAGNIYLHTDGTMVSECDENSDETVGGSKYIGIAGSENKTVGTSTF
AFGAGSDKQYIYVDGNRKVEVTGEENVEINQMQNVTIGQGQNITIESGGRTDIIGGGDLINCNGDRIEIV
DGVEDFSVTGNQFYSVDQNREFSVGGNDKYTVTGDRHIDVGGNHTGHSNGLTRAISSGSVQTIHFAEDYT
LTIGTAMENFVGAKFVTCSAIIGEINYGLRFGKGAMDLKDGNALIQKYGAIALEKCGIKIFS
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3008492-3006204 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGCCAGTTGAGGAAAACATTAGATTTATTTTCACTTCCACATCTCAGCCGGACGACACCTTTACTGTTG
CTGAATTTAACGGTACAGAGGCAATCTCTAAACTGTATGAATTTGACATAACTCTTTATGCCGATGACCC
TGATATAAACTTAAAAGAGGTGTTGAAAAATCCGGTAAAATTAAGAATTGAGAAAAACGGGGAAGAGCTT
CGAGTCTTTCATGGCATTCTATCCCGCTTTGAGCAGTTGCATGAGTATTCCGGACATATTTATTTTCGAG
CCATACTGGTTCCACGACTATGGATTTCCGACCAATACCTTGAAAACCAGCTCTTTCTCGATAAAAGTAT
TCCCGATATCATCGAAGAGGTGCTCAAACAAACCGGTCTTACCACTCATGATTATGAATTAAAACTGACT
GGTAACTATGCTCCATGGGAGTACATCTGCCAGTATAACGAAAGTGATTTTAATTTTATTTCCCGATGGA
TGGAACGGGAAGGAATCTATTATTATTTTCAACAGGGTGATGATGCAGAAAAACTGATTATTGCAGATGC
CTCCACTGCTCACGAAGATATCCCTTCCGGAGAATCAATCCGGTATTCACCACCGGATTCTCTCTCTCCT
TCCACCACTGAGCAGGTTCGCGAATTCACCTGCCATCAGCATCTGTTGCCTAAAAAAGTCATTCTGAAAG
ACTACAACTATCGCAAGCCTTCTCTTGATCTCAAGGGAGAGGCAGATGTGGACACAGAGGGGCGTGGTCA
TGTCTATATTTATGGAGAACATTTCAAAACACCGGAGGAGGGAAATGCCTTAGCCCGAATACGTGCTGAA
GAGATCCTCTGCCGTGAGGCTATATTTTATGGTGAAGGGACCGTACCACCTTTTCTTGCCGGTTATATTT
TTGAGATGCACGACCACTACAGGGACTCCTATAATCAGCGTTATCTGATAACAGAACTCTCTCATCAGGG
AGTACAGTCCACCTACCTGACCGGAACCGGTGATACGGTCGAAGAAACTGATATGCAGGGCCCATCTTAT
TTTAATAATTTCACCTGTATCCCAGCAGACGCCCAATTCAGGCCAGAAAGGTTGGCGGAAAAGCCCAAAT
TGAAGGGGACGCTTAACGGTACCGTTGATGCGGGTGGAGATGGTGAGTATGCTGAAATTGATGACGAAGG
TCGCTATAAGATAAAACTCCCCTTTGATCAAAGCGATTCTGCAGATGGAAAGGCTTCTCGGTGGGTGCGA
ATGGCACAGCCCTATGCCGGTGCTGACTATGGCATGCATTTTCCACTGCACAAGGGAACCGAGGTACTGC
TGACCTTTATTGATGGAGATCCGGATCGACCCATCATTTCCGGAACCGTTCCCAATCCTGAGACTGGCAG
CCCGGTAACAGGCTCTAACCAGACTCAGTCAATGATTCGTACCGCAGGTGGAAATCAAATCCGGATTGAA
GATTCCAACGGTGGGCAACAGATCCATATGTCATCACCAACTAAAGGATCCATTGTGTCATTAGGGGCAG
TTAATGCCGGTAATATTTATTTGCATACGGATGGGACAATGGTTTCGGAATGCGATGAAAACTCTGATGA
AACCGTTGGTGGCAGTAAATACATTGGAATTGCAGGAAGTGAAAATAAAACCGTAGGTACTTCAACTTTT
GCGTTTGGTGCAGGTTCTGACAAACAATATATTTATGTTGATGGAAATCGCAAAGTTGAGGTTACCGGAG
AAGAGAATGTCGAAATTAATCAGATGCAAAATGTCACCATTGGACAAGGACAGAATATTACCATAGAAAG
TGGAGGACGAACTGATATTATTGGAGGTGGAGATCTCATTAATTGCAATGGTGATAGGATTGAGATTGTC
GATGGCGTTGAAGATTTCTCTGTTACAGGAAATCAGTTTTATAGTGTCGACCAAAACAGAGAATTTTCTG
TAGGAGGAAATGATAAATACACAGTAACAGGCGATCGTCATATTGATGTCGGGGGGAATCATACCGGCCA
TAGTAACGGGTTGACACGGGCAATATCCAGTGGGAGTGTTCAGACGATACATTTTGCAGAGGACTACACC
CTCACCATCGGCACAGCAATGGAAAATTTTGTTGGTGCCAAATTTGTCACCTGCTCAGCTATTATAGGAG
AAATTAACTATGGCTTGAGATTTGGCAAAGGAGCAATGGATCTAAAAGACGGCAATGCTCTTATCCAAAA
ATATGGTGCCATAGCATTGGAAAAATGCGGTATTAAAATATTCAGTTAG