SecReT6
Protein ID: 451948293
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02699
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3008492..3011143 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDM1PI11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-37, Aligned region: 220..239
AAA_2 [PF07724], Evalue: 5.10E-37, Aligned region: 526..580
AAA_2 [PF07724], Evalue: 5.10E-37, Aligned region: 613..778
AAA [PF00004], Evalue: 2.40E-18, Aligned region: 222..352
AAA [PF00004], Evalue: 2.40E-18, Aligned region: 618..739
ClpB_D2-small [PF10431], Evalue: 1.20E-17, Aligned region: 534..557
ClpB_D2-small [PF10431], Evalue: 1.20E-17, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 266..301
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 408..453
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 600..661
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 682..711
AAA_5 [PF07728], Evalue: 2.40E-12, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 2.40E-12, Aligned region: 617..744
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 221..314
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 339..380
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 615..637
Arch_ATPase [PF01637], Evalue: 1.10E-05, Aligned region: 200..236
Arch_ATPase [PF01637], Evalue: 1.10E-05, Aligned region: 275..330
Arch_ATPase [PF01637], Evalue: 1.10E-05, Aligned region: 615..629
Arch_ATPase [PF01637], Evalue: 1.10E-05, Aligned region: 688..700
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 278..319
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 615..649
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 222..282
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 617..641
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 217..236
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 617..736
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 278..326
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 416..441
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 618..656
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 615..636
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 216..245
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 617..635
T2SE [PF00437], Evalue: 0.0013, Aligned region: 207..238
T2SE [PF00437], Evalue: 0.0013, Aligned region: 567..691
Clp_N [PF02861], Evalue: 0.0013, Aligned region: 26..74
AAA_18 [PF13238], Evalue: 0.0031, Aligned region: 222..290
AAA_18 [PF13238], Evalue: 0.0031, Aligned region: 414..443
AAA_18 [PF13238], Evalue: 0.0031, Aligned region: 618..646
ResIII [PF04851], Evalue: 0.0038, Aligned region: 211..243
ResIII [PF04851], Evalue: 0.0038, Aligned region: 290..303
ResIII [PF04851], Evalue: 0.0038, Aligned region: 515..584
ResIII [PF04851], Evalue: 0.0038, Aligned region: 595..638
Hpr_kinase_C [PF07475], Evalue: 0.0071, Aligned region: 223..234
Hpr_kinase_C [PF07475], Evalue: 0.0071, Aligned region: 618..647
DUF2075 [PF09848], Evalue: 0.0078, Aligned region: 222..324
DUF2075 [PF09848], Evalue: 0.0078, Aligned region: 617..638
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 213..239
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 615..629
AAA_29 [PF13555], Evalue: 0.0099, Aligned region: 216..238
AAA_29 [PF13555], Evalue: 0.0099, Aligned region: 615..642
Protein Sequence: 883 a.a.     [Download]
>gi|451948293|ref|YP_007468888.1| type VI secretion ATPase, ClpV1 family [Desulfocapsa sulfexigens DSM 10523]
MLTVDIKSLLGRLNPFCTRCLEAAAGLCVSRSHYEVTLEHFLSKLLEEDQSDLPLILRHYDIDPGKFSKG
IDHALEEFKTGNAAKPVFSPLLMEWFQESWLIASVDLDENGLRSGVLLLTLVNNPSRFGAGQFLDQLNGI
SFDGLKSEFWDIVKPSIEQPAPGEAGESKEVSGPRDSTALGKFCVDFTAKAKDGEIDPVFGRDLEIRQMV
DILARRRKNNPIVVGEAGVGKTAVVEGLALRIVEGDVPDLLENVSILGLDMGLLQAGAGVKGEFENRLKS
VINEIKASPKPIILFIDEAHTLIGAGGAAGQSDAANLLKPALARGELRTVAATTWSEYKKYFEKDPALAR
RFQLVKLEEPSTETAILILRGLKQKYEEAHGVIVRDDAIIAAAELSSRYISGRQLPDKAVDLLDTSAARV
KVLLTAKPDVIEDRERSVQALEREKKAMERDQLHGFAIDEERFSEIVAKIADLGKQLEALILQWKTEQEV
AGRLINSRKELFKLKEAATLEEPENKEIIPQLEKELVTLTEEFKSIQKDESLVRIEVDPDIVSKVVSDWT
GVPLGSVMRDQASNIVNLEEKMKDRIKGQDHGLAAIAEVIKAAKSGLKDPNQPLGIFLLVGPSGVGKTET
ALALADLILGGERFVTSINMSEFQERHTLSRLVGSPPGYVGYGEGGVLTEAVRQRPYSIVLLDEVEKANL
EVMNLFYQVFDKGSLSDGEGREIDFKNTIIFLTSNLATDVITEMTTGDADLPPEVIMNAVRPILSNHFKP
ALLARMTVVPYMTLPQDILSDIVKLKLNKLVKRLAETHKMKLTYSEEVIKQIAARCTEVETGARNIDHIM
NGTVLPQMSKEILTFMSAEAMPASVHLDMDQDGNFAIQFGGND
 
Nucleotide Sequence: 2652 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3011143-3008492 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGCTGACCGTAGACATTAAATCGCTATTAGGGCGCTTAAATCCTTTTTGTACCCGTTGTCTTGAGGCCG
CAGCCGGCCTGTGTGTTTCACGGAGCCATTATGAGGTAACCCTTGAGCATTTTCTTTCCAAACTCCTTGA
AGAAGATCAGTCTGATCTTCCCCTTATTTTACGTCATTATGATATAGATCCCGGAAAATTCAGTAAAGGT
ATTGATCATGCCCTTGAAGAATTCAAAACCGGAAATGCTGCCAAACCCGTTTTTTCTCCACTGTTGATGG
AATGGTTTCAGGAGTCCTGGCTGATTGCCTCGGTGGATCTTGATGAAAACGGACTTCGATCGGGAGTACT
GCTGCTAACCCTGGTCAACAATCCATCCCGCTTTGGTGCAGGACAATTTCTTGATCAATTGAATGGTATA
TCGTTTGATGGACTCAAGAGTGAATTCTGGGATATTGTTAAACCATCCATTGAACAGCCTGCTCCAGGTG
AGGCAGGAGAGAGTAAGGAGGTTTCAGGCCCCAGAGACTCCACGGCACTTGGAAAATTTTGTGTAGATTT
TACCGCGAAAGCTAAAGACGGTGAGATCGACCCGGTTTTTGGAAGAGATCTTGAAATACGACAAATGGTT
GATATCCTTGCAAGAAGAAGAAAAAACAATCCCATTGTGGTCGGAGAAGCAGGTGTTGGTAAAACTGCAG
TCGTTGAAGGCCTTGCCCTGAGGATAGTTGAAGGAGACGTACCTGATCTCCTTGAAAATGTATCTATTCT
CGGCCTTGACATGGGACTTCTTCAGGCAGGCGCCGGAGTCAAAGGAGAATTTGAGAATCGCCTCAAATCA
GTTATTAACGAGATCAAGGCATCACCAAAGCCGATCATCCTCTTTATCGACGAAGCTCATACCCTGATTG
GTGCCGGTGGTGCTGCTGGACAAAGCGATGCTGCGAACCTCCTCAAACCGGCTTTAGCCAGAGGCGAATT
ACGGACAGTTGCCGCCACAACCTGGTCTGAATACAAGAAATATTTCGAGAAGGACCCGGCCCTTGCCAGA
AGATTTCAACTTGTTAAACTTGAAGAACCTTCCACTGAAACAGCCATCCTTATCCTGCGTGGTTTAAAAC
AAAAGTACGAAGAGGCTCATGGGGTAATAGTCCGTGATGACGCTATTATTGCAGCAGCCGAACTTTCCAG
TCGCTATATTTCCGGCAGGCAGTTGCCTGATAAGGCTGTAGATCTGCTCGATACCAGTGCCGCCCGGGTC
AAGGTGCTTCTCACCGCTAAACCCGATGTAATTGAGGACAGAGAACGGAGTGTCCAGGCCCTGGAACGTG
AGAAAAAGGCCATGGAAAGAGATCAGCTTCATGGTTTTGCGATAGACGAAGAACGTTTTTCAGAAATCGT
GGCCAAAATAGCGGATCTTGGCAAACAACTGGAAGCCCTTATCCTGCAGTGGAAAACCGAGCAAGAAGTG
GCTGGTAGATTAATAAATTCACGAAAAGAGCTTTTCAAACTCAAGGAAGCCGCTACCCTTGAAGAACCTG
AGAACAAAGAGATAATTCCGCAACTTGAAAAAGAACTTGTAACACTGACAGAAGAATTTAAGTCTATCCA
GAAAGATGAGTCCCTGGTTCGCATAGAAGTTGATCCGGATATCGTTTCCAAAGTTGTATCGGATTGGACA
GGTGTCCCGCTCGGTAGTGTCATGCGTGATCAGGCTTCAAATATAGTAAACCTTGAAGAAAAGATGAAGG
ATCGCATCAAGGGACAGGATCACGGTCTTGCAGCGATTGCTGAAGTAATCAAAGCTGCAAAATCAGGACT
TAAAGATCCGAATCAGCCTCTTGGAATATTTTTACTGGTTGGACCAAGTGGAGTCGGCAAGACTGAGACA
GCCCTGGCTCTGGCCGATCTGATCCTTGGAGGGGAGCGATTTGTAACCTCCATTAACATGAGTGAATTTC
AGGAACGCCATACCCTGAGTCGACTGGTAGGTTCACCTCCAGGATATGTCGGCTATGGTGAAGGAGGTGT
GCTCACCGAAGCCGTTCGCCAGCGTCCCTATTCAATAGTTCTTCTGGATGAAGTTGAAAAGGCCAATCTT
GAGGTGATGAATCTCTTTTATCAGGTTTTTGATAAAGGCTCACTCTCCGATGGTGAAGGAAGAGAAATCG
ATTTCAAAAATACTATTATTTTTCTCACCTCCAATCTGGCAACCGATGTCATCACCGAAATGACCACCGG
CGACGCTGATCTGCCGCCAGAGGTCATTATGAATGCCGTTCGGCCTATTTTGAGCAATCATTTCAAGCCT
GCCCTCCTTGCACGAATGACGGTGGTTCCCTATATGACTTTACCGCAGGACATCTTAAGTGATATTGTAA
AATTAAAACTAAACAAGCTGGTTAAACGATTGGCCGAGACTCACAAGATGAAATTAACCTACAGCGAAGA
GGTTATTAAACAGATCGCGGCCAGGTGTACTGAAGTGGAAACCGGGGCAAGAAATATTGATCACATCATG
AATGGCACGGTTTTACCACAAATGTCCAAAGAAATTCTCACCTTCATGAGTGCTGAGGCGATGCCTGCAA
GTGTTCACCTCGATATGGATCAAGATGGTAACTTTGCTATACAATTTGGAGGGAATGACTAA