SecReT6
Protein ID: 451948294
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02700
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3011180..3012208 [-]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDM1PS96
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-80, Aligned region: 23..325
Protein Sequence: 342 a.a.     [Download]
>gi|451948294|ref|YP_007468889.1| type VI secretion protein, VC_A0111 family [Desulfocapsa sulfexigens DSM 10523]
MAGTDRGTSPDLKLDVKLSLLKEGENFSFFQVIRLLRLYLDSPSSESKAAPYQHNQIRIVPHLSLGFPAS
DIESIEEHCDQNDKSTFKIKTNFLSLYGSSSPLPTFYSEELLDEASEDTSASRDFLDIIHQRLYLLFFQS
WLKYRQFQQISEEEENSHLERLFCLLGLGEPEFRKNIQNPKDLLRYAGLFSQAPRSALGLKTLLSDALNL
PVDILSCLERKAKIPEDQRIQLGASVVALGCDSFLGEEIGDRMGRFRIEIGPLDEPEYRAFLPGSALYNK
VVMLTDLFVSDPLDYDIKVTMAGRQAKTVCLGGEQWSGLGLDSWLFSGEEIGEKSNLFYPQR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3012208-3011180 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGCCGGCACGGATAGGGGAACGTCCCCTGATTTAAAGCTAGATGTCAAGTTGTCCTTACTGAAAGAAG
GAGAGAACTTTTCTTTTTTTCAGGTCATTAGACTGCTCCGCCTTTATCTTGATTCTCCGTCCTCTGAGAG
TAAAGCAGCCCCCTACCAACATAATCAAATCCGGATTGTCCCCCATTTATCCCTTGGTTTTCCTGCAAGT
GATATTGAATCGATCGAAGAACATTGTGATCAGAATGACAAGAGTACGTTCAAAATAAAAACTAATTTTT
TAAGTTTATACGGGTCCTCATCTCCCCTGCCAACCTTTTACAGTGAGGAGCTGTTGGATGAGGCCTCAGA
AGACACATCTGCCAGCCGTGATTTCCTCGATATCATTCACCAAAGACTCTATCTCCTCTTTTTCCAAAGC
TGGTTGAAGTATCGGCAGTTTCAACAAATCAGTGAGGAAGAGGAGAATTCCCATCTGGAGCGTCTTTTTT
GCTTACTGGGTTTGGGAGAACCGGAATTCCGAAAAAATATTCAAAACCCCAAGGATTTACTTCGATATGC
CGGATTGTTCAGTCAGGCCCCAAGATCAGCCTTAGGCCTGAAAACCCTGCTTTCCGACGCTTTAAATCTT
CCCGTTGACATTCTCTCCTGCCTGGAACGAAAAGCGAAAATTCCTGAAGATCAGAGAATTCAGCTTGGTG
CATCTGTTGTCGCCCTTGGCTGTGACAGCTTTCTTGGAGAAGAGATTGGAGATCGAATGGGTCGGTTTCG
TATAGAAATAGGACCACTTGATGAACCAGAATATAGAGCATTTCTCCCCGGCAGCGCCTTGTATAATAAG
GTTGTCATGCTGACAGACCTCTTCGTCAGTGATCCTCTTGATTACGACATTAAGGTAACCATGGCGGGTC
GACAGGCCAAAACAGTCTGTCTTGGAGGCGAACAATGGTCGGGCCTTGGTCTTGACAGCTGGCTGTTTTC
TGGAGAAGAGATCGGAGAAAAAAGTAACCTGTTTTATCCTCAAAGATAA