SecReT6
Protein ID: 451948295
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02701
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3012172..3013905 [-]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDM1PC87
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.90E-183, Aligned region: 2..577
CBM_X2 [PF03442], Evalue: 0.0098, Aligned region: 130..196
Protein Sequence: 577 a.a.     [Download]
>gi|451948295|ref|YP_007468890.1| type VI secretion protein, VC_A0110 family [Desulfocapsa sulfexigens DSM 10523]
MLNHYYLQELAALRDLGAEFAETHPSIASMLSGSSADPDVERLLEGVAFLTGLIREKLDDDFPEIIHDLI
HLIWPHYLRPLPSAAIVAFQPKSSLKQALKIKKGVQLASVPVAGTTCLFQTCFDVEVQPIAITDVAFVET
PGMASSIRVTLQTKGGALNNLQLKNLQFHLAGDYSSASDKYFILRHYLRRIIIKAKDQDSEFSLTKEHLQ
PVGFNMADGVLPYPGNSFPGYRILQEYFTLPENFLFLNLTGLEKWFNRGEGTQFEIIFELNDIPFQIPRI
RTKDFILFATPVLNLFKHEADPVRLDHRMSEYRVRPAASNLTHFQVYSVDRVTGYIQGTATAREYQHFDH
FNRNGASGPVYNTSKRKSPSRRVTDTYISVSYPKKDGPPLPETLSIELTCTNGDLPDSIQVGDISQPTSS
TPEFITFSNISPPTSGAQPPLEKNLLWRLLGHLSLNYTSLADIKNLKTLLGLYLFPDTKDRTTLLANQKR
IDGLQKISSTPGDRLVNGLMMRGREIHMEARYDHFASQGDLYLFASILNEFLAVYSTFNSFTRFTLKESL
RGEIISWPARIGERPLI
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3013905-3012172 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGCTCAATCACTACTACCTTCAGGAACTTGCTGCCTTGCGTGATCTTGGGGCAGAATTTGCTGAAACGC
ACCCTTCCATAGCATCGATGTTGAGCGGTTCCTCTGCTGATCCCGATGTCGAACGACTGCTGGAAGGAGT
AGCTTTTCTGACCGGCCTCATCCGGGAAAAACTTGATGACGATTTTCCCGAAATCATCCACGATCTCATT
CATCTGATATGGCCGCATTACCTTAGACCATTACCTTCCGCTGCCATTGTCGCCTTCCAGCCCAAATCTT
CACTTAAACAGGCCTTAAAAATAAAAAAAGGTGTCCAACTGGCCTCGGTCCCCGTTGCCGGAACAACCTG
CCTCTTTCAAACCTGTTTTGATGTTGAGGTACAACCGATAGCGATCACGGATGTCGCTTTTGTGGAAACC
CCAGGAATGGCTTCCTCCATCCGGGTCACACTTCAAACAAAGGGTGGAGCTCTCAACAATCTTCAGCTAA
AAAATTTACAATTTCATCTGGCGGGTGACTACTCTTCTGCCAGTGACAAATATTTTATCCTTCGTCATTA
TCTACGTCGTATAATTATTAAGGCGAAAGATCAGGACTCCGAATTTTCCTTAACTAAAGAACATCTGCAA
CCTGTGGGATTCAATATGGCAGATGGCGTCTTGCCCTATCCCGGCAACTCTTTTCCTGGATACCGAATTC
TTCAGGAATATTTCACTCTCCCTGAGAATTTTCTTTTTCTTAATCTCACCGGGCTTGAAAAATGGTTCAA
TCGCGGAGAAGGAACACAATTTGAGATTATTTTTGAGTTAAACGACATTCCTTTTCAAATACCAAGAATC
CGTACAAAAGATTTCATTCTTTTTGCCACTCCTGTACTCAATCTTTTTAAGCATGAAGCAGACCCCGTCC
GTCTTGATCACCGGATGAGCGAATACCGTGTTCGGCCCGCTGCATCAAATTTAACTCATTTCCAGGTGTA
CTCGGTGGACAGGGTAACCGGTTACATCCAGGGAACTGCAACAGCAAGGGAATATCAACATTTTGACCAC
TTTAATCGAAACGGTGCATCTGGCCCTGTTTACAATACAAGTAAAAGGAAATCGCCATCACGCAGGGTGA
CCGACACCTATATTTCTGTAAGTTACCCTAAAAAAGATGGCCCACCACTTCCTGAGACTCTTAGCATCGA
ACTGACGTGCACCAATGGTGATCTTCCCGACAGTATCCAGGTTGGTGACATATCACAGCCCACAAGCTCA
ACTCCTGAATTCATCACCTTTTCCAATATAAGTCCACCCACATCCGGGGCTCAGCCACCTCTGGAGAAAA
ACCTCCTCTGGAGACTTCTCGGACATCTGTCCCTGAATTACACTTCACTTGCTGATATTAAAAATTTAAA
GACATTACTCGGCCTGTACCTTTTTCCTGACACTAAAGACAGAACGACTTTACTAGCCAATCAGAAGCGA
ATAGATGGTCTGCAGAAGATCAGTTCCACCCCTGGAGACAGGCTAGTAAACGGTCTTATGATGCGGGGGA
GGGAAATTCATATGGAGGCCCGTTATGATCACTTTGCAAGTCAAGGTGATCTCTATCTTTTTGCTTCAAT
CCTCAACGAATTTCTTGCAGTATATTCAACTTTTAATTCCTTTACCAGGTTCACCCTTAAAGAAAGTTTG
AGAGGAGAAATCATTTCATGGCCGGCACGGATAGGGGAACGTCCCCTGATTTAA