SecReT6
Protein ID: 451948296
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02702
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3013920..3014333 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDM1P6Z0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 27..115
Protein Sequence: 137 a.a.     [Download]
>gi|451948296|ref|YP_007468891.1| type VI secretion system lysozyme-related protein [Desulfocapsa sulfexigens DSM 10523]
MREARLLERIRQREHDPLRRESEDPLKVIDSIQDHLKQILNTRQGNVLISEEYGTPDFTEFLTEYPQSLR
GFERAIRQTITQYEPRLRAVRVAFTPQEEDRLAVKFQIFAKLATSGSNTSVLFESLLNSDGQISIKK
 
Nucleotide Sequence: 414 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3014333-3013920 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGCGGGAAGCCAGGTTATTAGAGCGTATCCGGCAGAGGGAGCATGACCCTCTCCGTCGGGAAAGTGAGG
ATCCGTTGAAGGTGATCGACTCCATCCAGGACCACCTGAAACAGATCCTCAATACCCGGCAGGGAAATGT
CCTGATTTCTGAAGAATACGGAACCCCTGATTTCACTGAATTTCTTACTGAATACCCTCAGTCACTCCGA
GGCTTTGAAAGGGCAATCAGACAGACAATTACCCAGTACGAACCACGACTGCGAGCCGTGCGGGTAGCCT
TTACCCCCCAGGAAGAAGATCGTCTTGCTGTGAAGTTTCAGATTTTTGCAAAACTTGCCACCTCAGGTTC
CAATACCTCAGTACTTTTTGAAAGTCTTTTAAATTCCGATGGTCAGATAAGCATAAAAAAATAA