SecReT6
Protein ID: 451948297
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02703
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3014384..3014872 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDM1NI24
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-33, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|451948297|ref|YP_007468892.1| type VI secretion system effector, Hcp1 family [Desulfocapsa sulfexigens DSM 10523]
MALNAYLKLTGETQGEIKGSVTQAGREDMIAIIAFDQEISSPRDAASGLPTGKRQHGPLTLVKEVDKSSP
LIYSAMVNNENITSLELRCWQPSSTGKEVQHYTIQLENASISKIRQEMLNNKYPENMQHKEREHVSFCYQ
KIIWTWEDGGITAEDDWEAPMV
 
Nucleotide Sequence: 489 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3014872-3014384 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGCATTAAATGCATACCTCAAGCTTACCGGAGAGACTCAGGGCGAGATTAAAGGATCTGTAACCCAGG
CAGGTCGTGAAGATATGATCGCTATAATTGCTTTTGATCAGGAAATATCTTCGCCAAGAGATGCAGCCTC
TGGACTTCCCACCGGAAAGAGACAACATGGCCCGCTCACCCTTGTCAAAGAGGTGGATAAGTCAAGTCCT
CTTATTTATTCAGCCATGGTCAATAATGAAAACATAACCAGCCTTGAGCTTCGGTGTTGGCAACCTTCCT
CAACCGGCAAGGAAGTACAGCACTACACCATCCAACTGGAAAATGCGTCCATCTCTAAAATACGTCAGGA
GATGCTTAACAACAAATATCCTGAAAATATGCAGCACAAAGAAAGAGAGCACGTCTCTTTTTGTTATCAA
AAAATAATATGGACCTGGGAAGATGGTGGCATTACGGCTGAAGATGATTGGGAAGCTCCAATGGTCTGA